BLASTX nr result
ID: Scutellaria22_contig00035930
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00035930 (372 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002302000.1| predicted protein [Populus trichocarpa] gi|2... 142 2e-32 ref|XP_004152758.1| PREDICTED: pentatricopeptide repeat-containi... 141 5e-32 ref|XP_003590744.1| Pentatricopeptide repeat-containing protein ... 140 8e-32 emb|CBI19832.3| unnamed protein product [Vitis vinifera] 137 9e-31 ref|XP_002280360.1| PREDICTED: pentatricopeptide repeat-containi... 137 9e-31 >ref|XP_002302000.1| predicted protein [Populus trichocarpa] gi|222843726|gb|EEE81273.1| predicted protein [Populus trichocarpa] Length = 797 Score = 142 bits (359), Expect = 2e-32 Identities = 61/76 (80%), Positives = 68/76 (89%) Frame = +3 Query: 3 KEHSLSTHSEKLAVVYGILKLPRRATIRIFKNLRICGDCHNAIKFMSKAEGREIIVRDGK 182 KEH LSTHSEKLAV YG +KLP AT+R+FKNLRICGDCHNA KFMSK GREI+VRDGK Sbjct: 722 KEHELSTHSEKLAVAYGFMKLPHGATVRVFKNLRICGDCHNAFKFMSKVVGREIVVRDGK 781 Query: 183 RFHHFKDGECSCGNYW 230 RFHHF+DG+CSCG+YW Sbjct: 782 RFHHFRDGKCSCGDYW 797 >ref|XP_004152758.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like [Cucumis sativus] gi|449504088|ref|XP_004162249.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like [Cucumis sativus] Length = 797 Score = 141 bits (356), Expect = 5e-32 Identities = 61/76 (80%), Positives = 71/76 (93%) Frame = +3 Query: 3 KEHSLSTHSEKLAVVYGILKLPRRATIRIFKNLRICGDCHNAIKFMSKAEGREIIVRDGK 182 KE++LSTHSEKLAV +G++KLP+ AT+R+FKNLRICGDCHNAIKFMSK GREI+VRDGK Sbjct: 722 KEYALSTHSEKLAVAFGLMKLPQGATVRVFKNLRICGDCHNAIKFMSKVVGREIVVRDGK 781 Query: 183 RFHHFKDGECSCGNYW 230 RFHHFK+GECSC NYW Sbjct: 782 RFHHFKNGECSCRNYW 797 >ref|XP_003590744.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355479792|gb|AES60995.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 795 Score = 140 bits (354), Expect = 8e-32 Identities = 63/76 (82%), Positives = 69/76 (90%) Frame = +3 Query: 3 KEHSLSTHSEKLAVVYGILKLPRRATIRIFKNLRICGDCHNAIKFMSKAEGREIIVRDGK 182 KEHSLSTHSEKLAVVYGI+KLP ATIR+FKNLRICGDCHNA K++SK REI+VRD K Sbjct: 720 KEHSLSTHSEKLAVVYGIMKLPLGATIRVFKNLRICGDCHNAFKYISKVVEREIVVRDRK 779 Query: 183 RFHHFKDGECSCGNYW 230 RFHHFK+GECSCGNYW Sbjct: 780 RFHHFKNGECSCGNYW 795 >emb|CBI19832.3| unnamed protein product [Vitis vinifera] Length = 544 Score = 137 bits (345), Expect = 9e-31 Identities = 61/76 (80%), Positives = 68/76 (89%) Frame = +3 Query: 3 KEHSLSTHSEKLAVVYGILKLPRRATIRIFKNLRICGDCHNAIKFMSKAEGREIIVRDGK 182 KE+ LSTHSEKLAV +G+LKLP AT+R+FKNLRICGDCHNA KFMSK REI+VRDGK Sbjct: 469 KEYVLSTHSEKLAVGFGLLKLPLGATVRVFKNLRICGDCHNAFKFMSKVVEREIVVRDGK 528 Query: 183 RFHHFKDGECSCGNYW 230 RFHHFK+GECSCGNYW Sbjct: 529 RFHHFKNGECSCGNYW 544 >ref|XP_002280360.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Vitis vinifera] Length = 799 Score = 137 bits (345), Expect = 9e-31 Identities = 61/76 (80%), Positives = 68/76 (89%) Frame = +3 Query: 3 KEHSLSTHSEKLAVVYGILKLPRRATIRIFKNLRICGDCHNAIKFMSKAEGREIIVRDGK 182 KE+ LSTHSEKLAV +G+LKLP AT+R+FKNLRICGDCHNA KFMSK REI+VRDGK Sbjct: 724 KEYVLSTHSEKLAVGFGLLKLPLGATVRVFKNLRICGDCHNAFKFMSKVVEREIVVRDGK 783 Query: 183 RFHHFKDGECSCGNYW 230 RFHHFK+GECSCGNYW Sbjct: 784 RFHHFKNGECSCGNYW 799