BLASTX nr result
ID: Scutellaria22_contig00035711
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00035711 (291 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAJ53258.1| JMS10C05.1 [Jatropha curcas] 132 3e-29 emb|CBI29860.3| unnamed protein product [Vitis vinifera] 118 4e-25 ref|XP_002283735.1| PREDICTED: pentatricopeptide repeat-containi... 118 4e-25 ref|XP_002529617.1| pentatricopeptide repeat-containing protein,... 116 2e-24 ref|XP_004167548.1| PREDICTED: pentatricopeptide repeat-containi... 115 3e-24 >dbj|BAJ53258.1| JMS10C05.1 [Jatropha curcas] Length = 563 Score = 132 bits (332), Expect = 3e-29 Identities = 57/92 (61%), Positives = 76/92 (82%) Frame = -2 Query: 278 PSPEPIHLFKELAGKKFPMSNTFTLAFVLKCCSMLPAFEEGKQVHKHVIASGFSENMFVK 99 PS EPIHLFK++ GK +P NTFT+AFVLK CS++ A EEGKQ+H ++ SGFS + +V+ Sbjct: 71 PSKEPIHLFKDMVGKGYPNPNTFTMAFVLKACSIIMALEEGKQIHAQILRSGFSSSPYVQ 130 Query: 98 TSLLNFYTKCEEVELGRKVFDEMTERNVVAWS 3 +SL+NFY+KCEE+ + RKVFDE+TERN+V WS Sbjct: 131 SSLVNFYSKCEEITIARKVFDEITERNLVCWS 162 >emb|CBI29860.3| unnamed protein product [Vitis vinifera] Length = 655 Score = 118 bits (296), Expect = 4e-25 Identities = 52/92 (56%), Positives = 73/92 (79%) Frame = -2 Query: 278 PSPEPIHLFKELAGKKFPMSNTFTLAFVLKCCSMLPAFEEGKQVHKHVIASGFSENMFVK 99 PS EP+ LF+++ + +P NTFT+AFVLK CS++ A EEG+QVH +V+ SGF + FV+ Sbjct: 140 PSKEPVILFRKMVRRGYPNPNTFTMAFVLKACSIVSALEEGQQVHANVLKSGFGSSPFVE 199 Query: 98 TSLLNFYTKCEEVELGRKVFDEMTERNVVAWS 3 T+L+NFY KCE++ L KVFDE+T+RN+VAWS Sbjct: 200 TALVNFYAKCEDIVLASKVFDEITDRNLVAWS 231 >ref|XP_002283735.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065 [Vitis vinifera] Length = 564 Score = 118 bits (296), Expect = 4e-25 Identities = 52/92 (56%), Positives = 73/92 (79%) Frame = -2 Query: 278 PSPEPIHLFKELAGKKFPMSNTFTLAFVLKCCSMLPAFEEGKQVHKHVIASGFSENMFVK 99 PS EP+ LF+++ + +P NTFT+AFVLK CS++ A EEG+QVH +V+ SGF + FV+ Sbjct: 71 PSKEPVILFRKMVRRGYPNPNTFTMAFVLKACSIVSALEEGQQVHANVLKSGFGSSPFVE 130 Query: 98 TSLLNFYTKCEEVELGRKVFDEMTERNVVAWS 3 T+L+NFY KCE++ L KVFDE+T+RN+VAWS Sbjct: 131 TALVNFYAKCEDIVLASKVFDEITDRNLVAWS 162 >ref|XP_002529617.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223530902|gb|EEF32762.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 438 Score = 116 bits (291), Expect = 2e-24 Identities = 50/94 (53%), Positives = 72/94 (76%) Frame = -2 Query: 284 RGPSPEPIHLFKELAGKKFPMSNTFTLAFVLKCCSMLPAFEEGKQVHKHVIASGFSENMF 105 + PS EP L+K + + FP +NTFT+AFVLK C+ + AFEEG+Q+H ++ SGFS N + Sbjct: 209 KNPSREPYFLYKSMVTRGFPRANTFTMAFVLKACASIMAFEEGRQIHARILRSGFSLNPY 268 Query: 104 VKTSLLNFYTKCEEVELGRKVFDEMTERNVVAWS 3 V++SL++ Y KCEE+ L ++VFDE+TERN+V WS Sbjct: 269 VQSSLVSLYGKCEEIRLAKQVFDEITERNLVCWS 302 >ref|XP_004167548.1| PREDICTED: pentatricopeptide repeat-containing protein At1g59720, mitochondrial-like [Cucumis sativus] Length = 376 Score = 115 bits (289), Expect = 3e-24 Identities = 53/91 (58%), Positives = 69/91 (75%) Frame = -2 Query: 275 SPEPIHLFKELAGKKFPMSNTFTLAFVLKCCSMLPAFEEGKQVHKHVIASGFSENMFVKT 96 S EPI LFK+L +P+ N+FTLAFVLK C+++ AF EG QVH HV+ GF ++FV+T Sbjct: 72 SKEPIFLFKKLTETGYPVPNSFTLAFVLKACAIVTAFGEGLQVHSHVLKDGFGSSLFVQT 131 Query: 95 SLLNFYTKCEEVELGRKVFDEMTERNVVAWS 3 SL+NFY KCEE+ RKVF+EM RN+VAW+ Sbjct: 132 SLVNFYGKCEEIGFARKVFEEMPVRNLVAWT 162