BLASTX nr result
ID: Scutellaria22_contig00035667
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00035667 (302 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003548250.1| PREDICTED: pentatricopeptide repeat-containi... 94 1e-17 ref|XP_003633947.1| PREDICTED: pentatricopeptide repeat-containi... 92 3e-17 emb|CBI40590.3| unnamed protein product [Vitis vinifera] 92 3e-17 ref|XP_002523296.1| pentatricopeptide repeat-containing protein,... 89 5e-16 ref|XP_004155716.1| PREDICTED: pentatricopeptide repeat-containi... 71 8e-11 >ref|XP_003548250.1| PREDICTED: pentatricopeptide repeat-containing protein At5g08510-like [Glycine max] Length = 512 Score = 94.0 bits (232), Expect = 1e-17 Identities = 47/75 (62%), Positives = 56/75 (74%), Gaps = 1/75 (1%) Frame = +3 Query: 69 MQQVKEIHAHTLRNGADFSKHFISKLFEIRNIKYAHKVLDNIPNPTLFFYNKLIQAYSHH 248 M+QVK+IH +TLRNG D +K I KL EI N+ YAHKVL + P PTLF YNKLIQAYS H Sbjct: 1 MRQVKQIHGYTLRNGIDQTKILIEKLLEIPNLHYAHKVLHHSPKPTLFLYNKLIQAYSSH 60 Query: 249 GPH-IRCLSLYSEVL 290 H +C SLYS++L Sbjct: 61 PQHQHQCFSLYSQML 75 >ref|XP_003633947.1| PREDICTED: pentatricopeptide repeat-containing protein At5g08510-like [Vitis vinifera] Length = 512 Score = 92.4 bits (228), Expect = 3e-17 Identities = 41/73 (56%), Positives = 55/73 (75%) Frame = +3 Query: 69 MQQVKEIHAHTLRNGADFSKHFISKLFEIRNIKYAHKVLDNIPNPTLFFYNKLIQAYSHH 248 M ++K+I A+TLRNG + +K I L +I +I YAHK+ D IP PT+F YNKLIQAYS H Sbjct: 1 MNRLKQIQAYTLRNGIEHTKQLIVSLLQIPSIPYAHKLFDFIPKPTVFLYNKLIQAYSSH 60 Query: 249 GPHIRCLSLYSEV 287 GPH +C SLY+++ Sbjct: 61 GPHHQCFSLYTQM 73 >emb|CBI40590.3| unnamed protein product [Vitis vinifera] Length = 495 Score = 92.4 bits (228), Expect = 3e-17 Identities = 41/73 (56%), Positives = 55/73 (75%) Frame = +3 Query: 69 MQQVKEIHAHTLRNGADFSKHFISKLFEIRNIKYAHKVLDNIPNPTLFFYNKLIQAYSHH 248 M ++K+I A+TLRNG + +K I L +I +I YAHK+ D IP PT+F YNKLIQAYS H Sbjct: 1 MNRLKQIQAYTLRNGIEHTKQLIVSLLQIPSIPYAHKLFDFIPKPTVFLYNKLIQAYSSH 60 Query: 249 GPHIRCLSLYSEV 287 GPH +C SLY+++ Sbjct: 61 GPHHQCFSLYTQM 73 >ref|XP_002523296.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223537384|gb|EEF39012.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 353 Score = 88.6 bits (218), Expect = 5e-16 Identities = 39/76 (51%), Positives = 55/76 (72%) Frame = +3 Query: 69 MQQVKEIHAHTLRNGADFSKHFISKLFEIRNIKYAHKVLDNIPNPTLFFYNKLIQAYSHH 248 M Q+K+IHA+TLRNG D++K +L +I N+ YAHK++D IP+P +F YNKLIQAYS Sbjct: 1 MNQLKQIHAYTLRNGIDYNKTLTERLIQIPNVPYAHKLIDLIPSPNVFLYNKLIQAYSFQ 60 Query: 249 GPHIRCLSLYSEVLDR 296 +C S+YS++ R Sbjct: 61 NQLHQCFSIYSQMRSR 76 >ref|XP_004155716.1| PREDICTED: pentatricopeptide repeat-containing protein At5g08510-like [Cucumis sativus] Length = 512 Score = 71.2 bits (173), Expect = 8e-11 Identities = 32/73 (43%), Positives = 48/73 (65%) Frame = +3 Query: 69 MQQVKEIHAHTLRNGADFSKHFISKLFEIRNIKYAHKVLDNIPNPTLFFYNKLIQAYSHH 248 M Q+K+IHA++LRNG D +K I KL ++ ++ YA + D IP P+++ YNK IQ +S Sbjct: 1 MNQLKQIHAYSLRNGLDHTKFLIEKLLQLPDLPYACTLFDQIPKPSVYLYNKFIQTFSSI 60 Query: 249 GPHIRCLSLYSEV 287 G RC LY ++ Sbjct: 61 GHPHRCWLLYCQM 73