BLASTX nr result
ID: Scutellaria22_contig00035008
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00035008 (225 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003547997.1| PREDICTED: UPF0496 protein At2g18630-like [G... 55 8e-06 >ref|XP_003547997.1| PREDICTED: UPF0496 protein At2g18630-like [Glycine max] Length = 376 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/39 (61%), Positives = 31/39 (79%) Frame = -2 Query: 224 SNQISMMERLQAKKRKLDSKLGKLKAWRRISNVIFVATF 108 + Q SM+++LQ +KRKLD KL LK W+R+SNVIFVA F Sbjct: 190 AQQASMLQKLQIRKRKLDKKLKSLKTWKRVSNVIFVAAF 228