BLASTX nr result
ID: Scutellaria22_contig00034393
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00034393 (285 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN75813.1| hypothetical protein VITISV_004634 [Vitis vinifera] 60 1e-07 >emb|CAN75813.1| hypothetical protein VITISV_004634 [Vitis vinifera] Length = 640 Score = 60.5 bits (145), Expect = 1e-07 Identities = 34/68 (50%), Positives = 41/68 (60%), Gaps = 1/68 (1%) Frame = -1 Query: 270 DKENDLTIGNDL-SPVLLDYEPCISKRVKEKSLSHRTDEFAESISTDAGGLVASDDSDWT 94 D ND + D S LD +P ++ KEK L R AES+STD GGLVAS DSDWT Sbjct: 571 DVGNDQILTADFGSSKFLDCKPGADRKGKEKLLPQRPIACAESVSTDGGGLVASGDSDWT 630 Query: 93 YFHENHLF 70 ++NHLF Sbjct: 631 LCYKNHLF 638