BLASTX nr result
ID: Scutellaria22_contig00034345
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00034345 (238 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_974672.1| calmodulin-binding protein [Arabidopsis thalian... 74 9e-12 ref|NP_195031.2| calmodulin-binding protein [Arabidopsis thalian... 74 9e-12 ref|XP_004142930.1| PREDICTED: uncharacterized protein LOC101218... 70 2e-10 ref|XP_002324731.1| predicted protein [Populus trichocarpa] gi|2... 69 5e-10 ref|XP_002514129.1| calmodulin binding protein, putative [Ricinu... 67 1e-09 >ref|NP_974672.1| calmodulin-binding protein [Arabidopsis thaliana] gi|332660766|gb|AEE86166.1| calmodulin-binding protein [Arabidopsis thaliana] Length = 526 Score = 74.3 bits (181), Expect = 9e-12 Identities = 41/81 (50%), Positives = 52/81 (64%), Gaps = 2/81 (2%) Frame = -1 Query: 238 QKLALHHWLEAVII-SLSILI-KFTIEIVFNN*QTCLFETQI*YLCLLIP*IDPRHRYGR 65 QKLAL HWLEAV +L+I + + ++ + + + T + +L L IDPRHRYG Sbjct: 187 QKLALQHWLEAVSPHNLNIFVTSYQRQVPYLTSKAIIEYTLMIHLLKLQ--IDPRHRYGH 244 Query: 64 NLHFYYDVWFEQKSYQPFFYW 2 NLHFYYDVW KS QPFFYW Sbjct: 245 NLHFYYDVWSASKSTQPFFYW 265 >ref|NP_195031.2| calmodulin-binding protein [Arabidopsis thaliana] gi|17064950|gb|AAL32629.1| putative protein [Arabidopsis thaliana] gi|30725580|gb|AAP37812.1| At4g33050 [Arabidopsis thaliana] gi|332660765|gb|AEE86165.1| calmodulin-binding protein [Arabidopsis thaliana] Length = 374 Score = 74.3 bits (181), Expect = 9e-12 Identities = 41/81 (50%), Positives = 52/81 (64%), Gaps = 2/81 (2%) Frame = -1 Query: 238 QKLALHHWLEAVII-SLSILI-KFTIEIVFNN*QTCLFETQI*YLCLLIP*IDPRHRYGR 65 QKLAL HWLEAV +L+I + + ++ + + + T + +L L IDPRHRYG Sbjct: 187 QKLALQHWLEAVSPHNLNIFVTSYQRQVPYLTSKAIIEYTLMIHLLKLQ--IDPRHRYGH 244 Query: 64 NLHFYYDVWFEQKSYQPFFYW 2 NLHFYYDVW KS QPFFYW Sbjct: 245 NLHFYYDVWSASKSTQPFFYW 265 >ref|XP_004142930.1| PREDICTED: uncharacterized protein LOC101218931 [Cucumis sativus] Length = 502 Score = 69.7 bits (169), Expect = 2e-10 Identities = 36/79 (45%), Positives = 37/79 (46%) Frame = -1 Query: 238 QKLALHHWLEAVIISLSILIKFTIEIVFNN*QTCLFETQI*YLCLLIP*IDPRHRYGRNL 59 QKLAL HWLEA IDPRHRYG NL Sbjct: 178 QKLALQHWLEA--------------------------------------IDPRHRYGHNL 199 Query: 58 HFYYDVWFEQKSYQPFFYW 2 HFYYDVWF+ KS QPFFYW Sbjct: 200 HFYYDVWFDSKSTQPFFYW 218 >ref|XP_002324731.1| predicted protein [Populus trichocarpa] gi|222866165|gb|EEF03296.1| predicted protein [Populus trichocarpa] Length = 531 Score = 68.6 bits (166), Expect = 5e-10 Identities = 35/79 (44%), Positives = 37/79 (46%) Frame = -1 Query: 238 QKLALHHWLEAVIISLSILIKFTIEIVFNN*QTCLFETQI*YLCLLIP*IDPRHRYGRNL 59 QKLAL HWLEA IDPRHRYG NL Sbjct: 212 QKLALQHWLEA--------------------------------------IDPRHRYGHNL 233 Query: 58 HFYYDVWFEQKSYQPFFYW 2 HFYYDVWF+ +S QPFFYW Sbjct: 234 HFYYDVWFDSRSTQPFFYW 252 >ref|XP_002514129.1| calmodulin binding protein, putative [Ricinus communis] gi|223546585|gb|EEF48083.1| calmodulin binding protein, putative [Ricinus communis] Length = 541 Score = 67.4 bits (163), Expect = 1e-09 Identities = 35/79 (44%), Positives = 36/79 (45%) Frame = -1 Query: 238 QKLALHHWLEAVIISLSILIKFTIEIVFNN*QTCLFETQI*YLCLLIP*IDPRHRYGRNL 59 QKLAL HWLEA IDPRHRYG NL Sbjct: 206 QKLALQHWLEA--------------------------------------IDPRHRYGHNL 227 Query: 58 HFYYDVWFEQKSYQPFFYW 2 HFYYDVWF +S QPFFYW Sbjct: 228 HFYYDVWFRSESTQPFFYW 246