BLASTX nr result
ID: Scutellaria22_contig00034226
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00034226 (276 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002324361.1| glutamate-gated kainate-type ion channel rec... 97 2e-18 ref|XP_002515378.1| glutamate receptor 2 plant, putative [Ricinu... 94 1e-17 ref|XP_002324375.1| glutamate-gated kainate-type ion channel rec... 92 4e-17 ref|XP_002515377.1| glutamate receptor 2 plant, putative [Ricinu... 91 7e-17 ref|XP_002308723.1| glutamate-gated kainate-type ion channel rec... 91 1e-16 >ref|XP_002324361.1| glutamate-gated kainate-type ion channel receptor subunit GluR5 [Populus trichocarpa] gi|222865795|gb|EEF02926.1| glutamate-gated kainate-type ion channel receptor subunit GluR5 [Populus trichocarpa] Length = 856 Score = 96.7 bits (239), Expect = 2e-18 Identities = 46/86 (53%), Positives = 61/86 (70%), Gaps = 1/86 (1%) Frame = -1 Query: 276 VFVMHMSQFLGTKLFLKARELGMMTEGYAWIVTSGLT-DLFSLVNSDVVEAMQGFLGVRP 100 VF++HM Q LGT+LF KA+E+GMM+EGY WI+T GLT DL S N V + MQG LG++P Sbjct: 227 VFIVHMYQSLGTRLFAKAKEIGMMSEGYVWIMTDGLTADLLSTPNYSVTDTMQGVLGIKP 286 Query: 99 VISKSKELQAMAARWIRASLQDNQDM 22 + ++KEL+ RW R QDN D+ Sbjct: 287 HVPRTKELKDFRVRWKRKFQQDNPDI 312 >ref|XP_002515378.1| glutamate receptor 2 plant, putative [Ricinus communis] gi|223545322|gb|EEF46827.1| glutamate receptor 2 plant, putative [Ricinus communis] Length = 931 Score = 93.6 bits (231), Expect = 1e-17 Identities = 42/82 (51%), Positives = 58/82 (70%) Frame = -1 Query: 276 VFVMHMSQFLGTKLFLKARELGMMTEGYAWIVTSGLTDLFSLVNSDVVEAMQGFLGVRPV 97 VF++HM LG++L KARE+GMM+EGY WI+T+G++D + V+E+MQG LGVRP Sbjct: 201 VFILHMLPSLGSRLLTKAREVGMMSEGYVWIMTNGMSDYLRSLTPSVIESMQGVLGVRPY 260 Query: 96 ISKSKELQAMAARWIRASLQDN 31 + K+KEL+ RW LQDN Sbjct: 261 VPKTKELEIFYVRWKSKFLQDN 282 >ref|XP_002324375.1| glutamate-gated kainate-type ion channel receptor subunit GluR5 [Populus trichocarpa] gi|222865809|gb|EEF02940.1| glutamate-gated kainate-type ion channel receptor subunit GluR5 [Populus trichocarpa] Length = 843 Score = 92.0 bits (227), Expect = 4e-17 Identities = 42/83 (50%), Positives = 59/83 (71%), Gaps = 1/83 (1%) Frame = -1 Query: 276 VFVMHMSQFLGTKLFLKARELGMMTEGYAWIVTSGL-TDLFSLVNSDVVEAMQGFLGVRP 100 VF++HM +LGT+LF KA+E+GMM+EGY WI+T GL TD S + V + +QG LG++P Sbjct: 220 VFIVHMYGYLGTRLFAKAKEIGMMSEGYVWIMTDGLTTDFLSSPSPSVTDTIQGVLGIKP 279 Query: 99 VISKSKELQAMAARWIRASLQDN 31 + ++KEL+ RW R LQDN Sbjct: 280 YVPRTKELENFRVRWKRKFLQDN 302 >ref|XP_002515377.1| glutamate receptor 2 plant, putative [Ricinus communis] gi|223545321|gb|EEF46826.1| glutamate receptor 2 plant, putative [Ricinus communis] Length = 961 Score = 91.3 bits (225), Expect = 7e-17 Identities = 41/82 (50%), Positives = 57/82 (69%) Frame = -1 Query: 276 VFVMHMSQFLGTKLFLKARELGMMTEGYAWIVTSGLTDLFSLVNSDVVEAMQGFLGVRPV 97 VF++HM LG++L KARE GMM+EGY WI+T+G++D + V+E+MQG LGV+P Sbjct: 225 VFILHMLPSLGSRLLTKAREAGMMSEGYVWIMTNGMSDYLRSLTPSVIESMQGVLGVKPY 284 Query: 96 ISKSKELQAMAARWIRASLQDN 31 + K+KEL+ RW LQDN Sbjct: 285 VPKTKELENFYVRWKSKFLQDN 306 >ref|XP_002308723.1| glutamate-gated kainate-type ion channel receptor subunit GluR5 [Populus trichocarpa] gi|222854699|gb|EEE92246.1| glutamate-gated kainate-type ion channel receptor subunit GluR5 [Populus trichocarpa] Length = 866 Score = 90.9 bits (224), Expect = 1e-16 Identities = 42/83 (50%), Positives = 59/83 (71%), Gaps = 1/83 (1%) Frame = -1 Query: 276 VFVMHMSQFLGTKLFLKARELGMMTEGYAWIVTSGLT-DLFSLVNSDVVEAMQGFLGVRP 100 VF++HM LGT+LF KA+E+GMM+EGY WI+T GL+ D S N V + +QG LG++P Sbjct: 205 VFIVHMYPSLGTRLFTKAKEIGMMSEGYVWIMTDGLSVDFLSSPNHSVTDTIQGVLGIKP 264 Query: 99 VISKSKELQAMAARWIRASLQDN 31 + ++KEL+ ARW R L+DN Sbjct: 265 YVPRTKELEYFRARWKRKFLRDN 287