BLASTX nr result
ID: Scutellaria22_contig00034044
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00034044 (286 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002275192.1| PREDICTED: probable pectinesterase/pectinest... 55 8e-06 >ref|XP_002275192.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 51 [Vitis vinifera] Length = 553 Score = 54.7 bits (130), Expect = 8e-06 Identities = 29/60 (48%), Positives = 40/60 (66%) Frame = +2 Query: 107 IHGVCKASRDPPTCQASLSRPNHAPPPDATVLQAVEAASRVSSEHLETGRSMVRDILDSA 286 I CKA+R P TC+A L H PP + V Q +++A VSSE+L+T +SMV+ ILDS+ Sbjct: 40 IQQACKATRFPETCEAFLRGSGHVPPNPSPV-QIIQSAIWVSSENLKTAQSMVKSILDSS 98