BLASTX nr result
ID: Scutellaria22_contig00033947
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00033947 (252 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524800.1| transferase, transferring glycosyl groups, p... 129 3e-28 ref|XP_002311936.1| glycosyltransferase, CAZy family GT8 [Populu... 123 2e-26 ref|XP_002271296.1| PREDICTED: probable galacturonosyltransferas... 122 4e-26 ref|XP_004148897.1| PREDICTED: probable galacturonosyltransferas... 121 7e-26 ref|XP_002315420.1| glycosyltransferase, CAZy family GT8 [Populu... 120 1e-25 >ref|XP_002524800.1| transferase, transferring glycosyl groups, putative [Ricinus communis] gi|223535984|gb|EEF37643.1| transferase, transferring glycosyl groups, putative [Ricinus communis] Length = 350 Score = 129 bits (323), Expect = 3e-28 Identities = 59/82 (71%), Positives = 70/82 (85%) Frame = +3 Query: 6 VHIAMTLDANYLRGTMAAVLSILHHSSCPENVVFHFVWLGYHPDVLSTIVSSFPDLNFKV 185 +H+ MTLDANYLRGTMAAVLSIL HS+CPENV FHF+W + P+V S I S+FP LNFK+ Sbjct: 66 IHVTMTLDANYLRGTMAAVLSILQHSTCPENVEFHFLWAHFEPEVFSNIKSTFPYLNFKI 125 Query: 186 YTFDTSRVRGLISKSVRQALDQ 251 Y FD++RVRG ISKS+RQALDQ Sbjct: 126 YRFDSNRVRGKISKSIRQALDQ 147 >ref|XP_002311936.1| glycosyltransferase, CAZy family GT8 [Populus trichocarpa] gi|222851756|gb|EEE89303.1| glycosyltransferase, CAZy family GT8 [Populus trichocarpa] Length = 347 Score = 123 bits (308), Expect = 2e-26 Identities = 58/82 (70%), Positives = 69/82 (84%) Frame = +3 Query: 6 VHIAMTLDANYLRGTMAAVLSILHHSSCPENVVFHFVWLGYHPDVLSTIVSSFPDLNFKV 185 +HI MTLDANYLRGTMAAVLSIL HS+CPEN+ FHF+W + +V S+I S+FP LNFK Sbjct: 63 IHIVMTLDANYLRGTMAAVLSILQHSTCPENMEFHFLWSRFEREVFSSIKSTFPYLNFKF 122 Query: 186 YTFDTSRVRGLISKSVRQALDQ 251 Y FD++RVRG ISKS+RQALDQ Sbjct: 123 YRFDSNRVRGKISKSIRQALDQ 144 >ref|XP_002271296.1| PREDICTED: probable galacturonosyltransferase-like 4 [Vitis vinifera] Length = 356 Score = 122 bits (305), Expect = 4e-26 Identities = 55/82 (67%), Positives = 70/82 (85%) Frame = +3 Query: 6 VHIAMTLDANYLRGTMAAVLSILHHSSCPENVVFHFVWLGYHPDVLSTIVSSFPDLNFKV 185 +H+ MTLDANYLRGT+AA+LSIL HS+CPEN+ FHF+W + D+ S+I S+FP LNFKV Sbjct: 72 IHVVMTLDANYLRGTIAALLSILQHSTCPENIDFHFLWSHFESDIFSSINSTFPFLNFKV 131 Query: 186 YTFDTSRVRGLISKSVRQALDQ 251 Y FD++RVRG ISKS+R+ALDQ Sbjct: 132 YRFDSNRVRGKISKSIRRALDQ 153 >ref|XP_004148897.1| PREDICTED: probable galacturonosyltransferase-like 4-like, partial [Cucumis sativus] gi|449491609|ref|XP_004158951.1| PREDICTED: probable galacturonosyltransferase-like 4-like, partial [Cucumis sativus] Length = 341 Score = 121 bits (303), Expect = 7e-26 Identities = 56/82 (68%), Positives = 67/82 (81%) Frame = +3 Query: 6 VHIAMTLDANYLRGTMAAVLSILHHSSCPENVVFHFVWLGYHPDVLSTIVSSFPDLNFKV 185 +H+AMTLD+NYLRGTMAAVLSIL HS+CPENV FHF+W + +V S I S+FP L F++ Sbjct: 57 IHVAMTLDSNYLRGTMAAVLSILQHSTCPENVEFHFLWARFEGEVFSCIKSTFPYLKFRI 116 Query: 186 YTFDTSRVRGLISKSVRQALDQ 251 Y FD RVRG ISKS+RQALDQ Sbjct: 117 YRFDAGRVRGKISKSIRQALDQ 138 >ref|XP_002315420.1| glycosyltransferase, CAZy family GT8 [Populus trichocarpa] gi|222864460|gb|EEF01591.1| glycosyltransferase, CAZy family GT8 [Populus trichocarpa] Length = 348 Score = 120 bits (300), Expect = 1e-25 Identities = 55/82 (67%), Positives = 68/82 (82%) Frame = +3 Query: 6 VHIAMTLDANYLRGTMAAVLSILHHSSCPENVVFHFVWLGYHPDVLSTIVSSFPDLNFKV 185 +HI MTLDANYLRGTMAA+ SIL HS+CPEN+ FHF+W + +V S+I S+FP LNFK Sbjct: 64 IHIVMTLDANYLRGTMAAIFSILRHSTCPENMEFHFLWARFDREVFSSIKSTFPYLNFKF 123 Query: 186 YTFDTSRVRGLISKSVRQALDQ 251 Y FD++RVRG ISKS+RQ+LDQ Sbjct: 124 YRFDSNRVRGKISKSIRQSLDQ 145