BLASTX nr result
ID: Scutellaria22_contig00033817
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00033817 (412 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002282216.1| PREDICTED: MLO13 protein [Vitis vinifera] 55 4e-06 >ref|XP_002282216.1| PREDICTED: MLO13 protein [Vitis vinifera] Length = 587 Score = 55.5 bits (132), Expect = 4e-06 Identities = 38/90 (42%), Positives = 52/90 (57%), Gaps = 12/90 (13%) Frame = +1 Query: 1 SVQTSPRKSNYD--HSDSDGSPSPTAIHRPATDGFLPYHHPIE--AELHHD--------S 144 S+Q SPR+SN D H ++DGSPSP+ H DG +H+ + L HD S Sbjct: 500 SLQASPRRSNLDMEHWETDGSPSPSHPHH--GDGSSSHHNQLHQGTSLEHDRDISAPSSS 557 Query: 145 QVAPLPVVSDRHEHEIDIDHLPKDFSFSKR 234 QV PLP + H+HEID+ + K+FSF +R Sbjct: 558 QVVPLPQPT-LHQHEIDV--VRKEFSFDRR 584