BLASTX nr result
ID: Scutellaria22_contig00033591
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00033591 (251 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528587.1| DNA binding protein, putative [Ricinus commu... 102 2e-20 ref|XP_004161246.1| PREDICTED: heat stress transcription factor ... 102 4e-20 ref|XP_004137871.1| PREDICTED: heat stress transcription factor ... 102 4e-20 ref|NP_001234854.1| heat stress transcription factor A3 [Solanum... 100 9e-20 gb|AAF74563.1|AF208544_1 heat stress transcription factor A3 [So... 98 6e-19 >ref|XP_002528587.1| DNA binding protein, putative [Ricinus communis] gi|223531983|gb|EEF33795.1| DNA binding protein, putative [Ricinus communis] Length = 521 Score = 102 bits (255), Expect = 2e-20 Identities = 53/86 (61%), Positives = 67/86 (77%), Gaps = 3/86 (3%) Frame = +3 Query: 3 FVRGHRHLLKNIQRRKTPHSQQIGSSS---EDAGKAELEGEIESLRRERSLMMQEVLELK 173 F RG RHLLKNIQRRK SQQ+GS + + G +ELE EIE LR++RS+MMQEV+EL+ Sbjct: 163 FRRGKRHLLKNIQRRKPLQSQQVGSYTGPPTETGLSELESEIEILRKQRSMMMQEVVELQ 222 Query: 174 HEQRGTVQHMEMVNEKLQTAEKRQKQ 251 +QRG+V HM+ VN +LQ AE+RQKQ Sbjct: 223 QQQRGSVHHMKTVNRRLQAAEQRQKQ 248 >ref|XP_004161246.1| PREDICTED: heat stress transcription factor A-3-like [Cucumis sativus] Length = 564 Score = 102 bits (253), Expect = 4e-20 Identities = 51/86 (59%), Positives = 68/86 (79%), Gaps = 3/86 (3%) Frame = +3 Query: 3 FVRGHRHLLKNIQRRKTPHSQQIGS---SSEDAGKAELEGEIESLRRERSLMMQEVLELK 173 F RG +HLLKNIQRRK+ HSQQIGS S GK+ L+ EI L++ERS++MQEV+EL+ Sbjct: 212 FQRGKKHLLKNIQRRKSSHSQQIGSLIGPSTGGGKSGLKDEIGRLKKERSMLMQEVVELQ 271 Query: 174 HEQRGTVQHMEMVNEKLQTAEKRQKQ 251 +Q+GT QH+ VN++LQ+AE+RQKQ Sbjct: 272 QQQKGTAQHVNTVNQRLQSAEQRQKQ 297 >ref|XP_004137871.1| PREDICTED: heat stress transcription factor A-3-like [Cucumis sativus] Length = 564 Score = 102 bits (253), Expect = 4e-20 Identities = 51/86 (59%), Positives = 68/86 (79%), Gaps = 3/86 (3%) Frame = +3 Query: 3 FVRGHRHLLKNIQRRKTPHSQQIGS---SSEDAGKAELEGEIESLRRERSLMMQEVLELK 173 F RG +HLLKNIQRRK+ HSQQIGS S GK+ L+ EI L++ERS++MQEV+EL+ Sbjct: 212 FQRGKKHLLKNIQRRKSSHSQQIGSLIGPSTGGGKSGLKDEIGRLKKERSMLMQEVVELQ 271 Query: 174 HEQRGTVQHMEMVNEKLQTAEKRQKQ 251 +Q+GT QH+ VN++LQ+AE+RQKQ Sbjct: 272 QQQKGTAQHVNTVNQRLQSAEQRQKQ 297 >ref|NP_001234854.1| heat stress transcription factor A3 [Solanum lycopersicum] gi|264666931|gb|ACY71071.1| heat stress transcription factor A3 [Solanum lycopersicum] Length = 506 Score = 100 bits (250), Expect = 9e-20 Identities = 53/83 (63%), Positives = 63/83 (75%) Frame = +3 Query: 3 FVRGHRHLLKNIQRRKTPHSQQIGSSSEDAGKAELEGEIESLRRERSLMMQEVLELKHEQ 182 F RG RHLLKNIQRR++ SS +AGK ++ EIE LR E+SLMMQEV+EL+ +Q Sbjct: 170 FSRGKRHLLKNIQRRRSHQGGSSSGSSAEAGKGTMD-EIEKLRNEKSLMMQEVVELQQQQ 228 Query: 183 RGTVQHMEMVNEKLQTAEKRQKQ 251 RGTVQ ME VNEKLQ AE+RQKQ Sbjct: 229 RGTVQQMESVNEKLQAAEQRQKQ 251 >gb|AAF74563.1|AF208544_1 heat stress transcription factor A3 [Solanum peruvianum] Length = 508 Score = 98.2 bits (243), Expect = 6e-19 Identities = 52/83 (62%), Positives = 62/83 (74%) Frame = +3 Query: 3 FVRGHRHLLKNIQRRKTPHSQQIGSSSEDAGKAELEGEIESLRRERSLMMQEVLELKHEQ 182 F RG RHLLKNIQRR++ SS +AGK ++ EIE LR E+SLMMQEV+EL+ +Q Sbjct: 172 FSRGKRHLLKNIQRRRSQQGGSSSGSSAEAGKGTMD-EIEKLRNEKSLMMQEVVELQQQQ 230 Query: 183 RGTVQHMEMVNEKLQTAEKRQKQ 251 GTVQ ME VNEKLQ AE+RQKQ Sbjct: 231 HGTVQLMESVNEKLQAAEQRQKQ 253