BLASTX nr result
ID: Scutellaria22_contig00033554
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00033554 (290 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002297657.1| predicted protein [Populus trichocarpa] gi|2... 63 3e-08 ref|XP_002975569.1| hypothetical protein SELMODRAFT_150691 [Sela... 62 5e-08 gb|AAG50539.1|AC079828_10 unknown protein [Arabidopsis thaliana] 62 6e-08 ref|XP_002973542.1| hypothetical protein SELMODRAFT_58058 [Selag... 62 6e-08 ref|XP_002528121.1| structural molecule, putative [Ricinus commu... 62 6e-08 >ref|XP_002297657.1| predicted protein [Populus trichocarpa] gi|222844915|gb|EEE82462.1| predicted protein [Populus trichocarpa] Length = 399 Score = 62.8 bits (151), Expect = 3e-08 Identities = 30/36 (83%), Positives = 32/36 (88%), Gaps = 1/36 (2%) Frame = +1 Query: 1 LGDEAKGWLDTTYLSPSGNIRISRGNK-VTYTLQTK 105 LGDEAKGWLDTTYLSPSGN+RISRGNK T+ LQ K Sbjct: 205 LGDEAKGWLDTTYLSPSGNLRISRGNKGTTFVLQKK 240 >ref|XP_002975569.1| hypothetical protein SELMODRAFT_150691 [Selaginella moellendorffii] gi|300156570|gb|EFJ23198.1| hypothetical protein SELMODRAFT_150691 [Selaginella moellendorffii] Length = 392 Score = 62.0 bits (149), Expect = 5e-08 Identities = 30/34 (88%), Positives = 31/34 (91%), Gaps = 1/34 (2%) Frame = +1 Query: 1 LGDEAKGWLDTTYLSPSGNIRISRGNK-VTYTLQ 99 LGDEAKGWLDTTYLSPSGNIRISRGNK T+ LQ Sbjct: 196 LGDEAKGWLDTTYLSPSGNIRISRGNKGTTFVLQ 229 >gb|AAG50539.1|AC079828_10 unknown protein [Arabidopsis thaliana] Length = 257 Score = 61.6 bits (148), Expect = 6e-08 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +1 Query: 1 LGDEAKGWLDTTYLSPSGNIRISRGNKVTYTLQTK 105 LGDEAKGWLDTTYLSPSGN+RISRGNKV L ++ Sbjct: 220 LGDEAKGWLDTTYLSPSGNLRISRGNKVNEFLDSQ 254 >ref|XP_002973542.1| hypothetical protein SELMODRAFT_58058 [Selaginella moellendorffii] gi|300158580|gb|EFJ25202.1| hypothetical protein SELMODRAFT_58058 [Selaginella moellendorffii] Length = 174 Score = 61.6 bits (148), Expect = 6e-08 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +1 Query: 1 LGDEAKGWLDTTYLSPSGNIRISRGNKV 84 LGDEAKGWLDTTYLSPSGNIRISRGNKV Sbjct: 146 LGDEAKGWLDTTYLSPSGNIRISRGNKV 173 >ref|XP_002528121.1| structural molecule, putative [Ricinus communis] gi|223532460|gb|EEF34251.1| structural molecule, putative [Ricinus communis] Length = 409 Score = 61.6 bits (148), Expect = 6e-08 Identities = 29/36 (80%), Positives = 32/36 (88%), Gaps = 1/36 (2%) Frame = +1 Query: 1 LGDEAKGWLDTTYLSPSGNIRISRGNK-VTYTLQTK 105 LGDEAKGWLDTTYLSPSGN+RISRGNK T+ LQ + Sbjct: 215 LGDEAKGWLDTTYLSPSGNLRISRGNKGTTFVLQKR 250