BLASTX nr result
ID: Scutellaria22_contig00033514
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00033514 (315 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002265012.1| PREDICTED: ABC transporter C family member 4... 54 1e-05 >ref|XP_002265012.1| PREDICTED: ABC transporter C family member 4-like [Vitis vinifera] Length = 1509 Score = 54.3 bits (129), Expect = 1e-05 Identities = 24/42 (57%), Positives = 31/42 (73%) Frame = +3 Query: 189 VGHSTHSPVSAIPQWLGFVFLSPCSQRVLLSSVDILFLVVLL 314 + S +P S I QWL F+FLSPC QR LLSS+D+LFL+ L+ Sbjct: 17 IASSGETPFSLILQWLRFIFLSPCPQRALLSSIDLLFLLTLI 58