BLASTX nr result
ID: Scutellaria22_contig00033512
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00033512 (248 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002277713.1| PREDICTED: probable cellulose synthase A cat... 82 3e-14 ref|XP_002283406.1| PREDICTED: probable cellulose synthase A cat... 82 4e-14 gb|AAY60848.1| cellulose synthase 6 [Eucalyptus grandis] 81 8e-14 ref|XP_002459635.1| hypothetical protein SORBIDRAFT_02g007810 [S... 81 1e-13 gb|AFZ78555.1| cellulose synthase [Populus tomentosa] 80 1e-13 >ref|XP_002277713.1| PREDICTED: probable cellulose synthase A catalytic subunit 5 [UDP-forming] [Vitis vinifera] Length = 1091 Score = 82.4 bits (202), Expect = 3e-14 Identities = 37/42 (88%), Positives = 42/42 (100%) Frame = -2 Query: 247 RNRTPSIILVWSILLASIFSLLWLRIDPFLAKSDGPVLEDCG 122 +NRTP+II+VWSILLASIFSLLW+RIDPFLAKSDGPVLE+CG Sbjct: 1046 QNRTPTIIIVWSILLASIFSLLWVRIDPFLAKSDGPVLEECG 1087 >ref|XP_002283406.1| PREDICTED: probable cellulose synthase A catalytic subunit 3 [UDP-forming]-like [Vitis vinifera] Length = 1096 Score = 82.0 bits (201), Expect = 4e-14 Identities = 36/42 (85%), Positives = 42/42 (100%) Frame = -2 Query: 247 RNRTPSIILVWSILLASIFSLLWLRIDPFLAKSDGPVLEDCG 122 +NRTP+II+VWSILLASIFSLLW+R+DPFLAKSDGPVLE+CG Sbjct: 1051 QNRTPTIIIVWSILLASIFSLLWVRVDPFLAKSDGPVLEECG 1092 >gb|AAY60848.1| cellulose synthase 6 [Eucalyptus grandis] Length = 1097 Score = 81.3 bits (199), Expect = 8e-14 Identities = 36/42 (85%), Positives = 42/42 (100%) Frame = -2 Query: 247 RNRTPSIILVWSILLASIFSLLWLRIDPFLAKSDGPVLEDCG 122 +NRTP+II+VWSILLASIFSLLW+RIDPFLAKSDGP+LE+CG Sbjct: 1052 QNRTPTIIIVWSILLASIFSLLWVRIDPFLAKSDGPLLEECG 1093 >ref|XP_002459635.1| hypothetical protein SORBIDRAFT_02g007810 [Sorghum bicolor] gi|241923012|gb|EER96156.1| hypothetical protein SORBIDRAFT_02g007810 [Sorghum bicolor] Length = 1100 Score = 80.9 bits (198), Expect = 1e-13 Identities = 35/42 (83%), Positives = 42/42 (100%) Frame = -2 Query: 247 RNRTPSIILVWSILLASIFSLLWLRIDPFLAKSDGPVLEDCG 122 +NRTP+I++VWSILLASIFSLLW+RIDPFLAKSDGP+LE+CG Sbjct: 1055 QNRTPTIVIVWSILLASIFSLLWVRIDPFLAKSDGPLLEECG 1096 >gb|AFZ78555.1| cellulose synthase [Populus tomentosa] Length = 1087 Score = 80.5 bits (197), Expect = 1e-13 Identities = 35/42 (83%), Positives = 42/42 (100%) Frame = -2 Query: 247 RNRTPSIILVWSILLASIFSLLWLRIDPFLAKSDGPVLEDCG 122 RNRTP+II+VWSILLASIFSLLW+R+DPFLAKS+GP+LE+CG Sbjct: 1042 RNRTPTIIIVWSILLASIFSLLWVRVDPFLAKSNGPLLEECG 1083