BLASTX nr result
ID: Scutellaria22_contig00033481
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00033481 (245 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526551.1| set domain protein, putative [Ricinus commun... 55 4e-06 >ref|XP_002526551.1| set domain protein, putative [Ricinus communis] gi|223534112|gb|EEF35829.1| set domain protein, putative [Ricinus communis] Length = 832 Score = 55.5 bits (132), Expect = 4e-06 Identities = 25/40 (62%), Positives = 31/40 (77%) Frame = +1 Query: 124 RVAKAFGAMRAIGVKDDKVKPALLNLLRLYNKNWAPIEDE 243 RV AF AM+AIG+ +DKVKP L LL+LY+KNW IE+E Sbjct: 6 RVVSAFRAMKAIGINEDKVKPVLKKLLKLYDKNWELIEEE 45