BLASTX nr result
ID: Scutellaria22_contig00033455
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00033455 (385 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_983994.1| ADL102Cp [Ashbya gossypii ATCC 10895] gi|449825... 57 1e-06 ref|XP_003646239.1| hypothetical protein Ecym_4364 [Eremothecium... 57 1e-06 ref|XP_001643252.1| hypothetical protein Kpol_1063p4 [Vanderwalt... 57 1e-06 ref|XP_003954827.1| hypothetical protein KAFR_0A02560 [Kazachsta... 57 2e-06 ref|XP_003684384.1| hypothetical protein TPHA_0B02780 [Tetrapisi... 57 2e-06 >ref|NP_983994.1| ADL102Cp [Ashbya gossypii ATCC 10895] gi|44982532|gb|AAS51818.1| ADL102Cp [Ashbya gossypii ATCC 10895] gi|374107207|gb|AEY96115.1| FADL102Cp [Ashbya gossypii FDAG1] Length = 372 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +3 Query: 276 FCLMEFQRYIFMLV*ALDYCHSLGIMHRDVKPHNVM 383 F M+ + Y+F L+ ALDYCHS+GIMHRDVKPHNVM Sbjct: 166 FSDMDIRYYMFELLKALDYCHSMGIMHRDVKPHNVM 201 >ref|XP_003646239.1| hypothetical protein Ecym_4364 [Eremothecium cymbalariae DBVPG#7215] gi|356889874|gb|AET39422.1| hypothetical protein Ecym_4364 [Eremothecium cymbalariae DBVPG#7215] Length = 375 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +3 Query: 276 FCLMEFQRYIFMLV*ALDYCHSLGIMHRDVKPHNVM 383 F M+ + Y+F L+ ALDYCHS+GIMHRDVKPHNVM Sbjct: 169 FTDMDIRYYMFELLKALDYCHSMGIMHRDVKPHNVM 204 >ref|XP_001643252.1| hypothetical protein Kpol_1063p4 [Vanderwaltozyma polyspora DSM 70294] gi|156113854|gb|EDO15394.1| hypothetical protein Kpol_1063p4 [Vanderwaltozyma polyspora DSM 70294] Length = 380 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +3 Query: 276 FCLMEFQRYIFMLV*ALDYCHSLGIMHRDVKPHNVM 383 F M+ + Y+F L+ ALDYCHS+GIMHRDVKPHNVM Sbjct: 168 FTDMDMRYYMFELLKALDYCHSMGIMHRDVKPHNVM 203 >ref|XP_003954827.1| hypothetical protein KAFR_0A02560 [Kazachstania africana CBS 2517] gi|372461409|emb|CCF55692.1| hypothetical protein KAFR_0A02560 [Kazachstania africana CBS 2517] Length = 367 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = +3 Query: 285 MEFQRYIFMLV*ALDYCHSLGIMHRDVKPHNVM 383 +E + Y+F L+ ALDYCHS+GIMHRDVKPHNVM Sbjct: 170 LEIRYYMFELLKALDYCHSMGIMHRDVKPHNVM 202 >ref|XP_003684384.1| hypothetical protein TPHA_0B02780 [Tetrapisispora phaffii CBS 4417] gi|357522680|emb|CCE61950.1| hypothetical protein TPHA_0B02780 [Tetrapisispora phaffii CBS 4417] Length = 380 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = +3 Query: 285 MEFQRYIFMLV*ALDYCHSLGIMHRDVKPHNVM 383 M+ + Y+F L+ ALDYCHS+GIMHRDVKPHNVM Sbjct: 170 MDIKYYMFELLKALDYCHSMGIMHRDVKPHNVM 202