BLASTX nr result
ID: Scutellaria22_contig00033308
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00033308 (377 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAU90326.1| Putative kinase interacting protein, identical [S... 68 9e-10 >gb|AAU90326.1| Putative kinase interacting protein, identical [Solanum demissum] Length = 372 Score = 67.8 bits (164), Expect = 9e-10 Identities = 33/48 (68%), Positives = 41/48 (85%), Gaps = 1/48 (2%) Frame = -1 Query: 143 RRRNFNKPSWLLCTIADLDEKMNMLTRKI-SKGHKSPDSFAERANSYY 3 +RR+F++PSWLLCT+ADLDEKMN + KI KG SPDSFAERA++YY Sbjct: 25 KRRSFSRPSWLLCTVADLDEKMNKVALKIPEKG--SPDSFAERADAYY 70