BLASTX nr result
ID: Scutellaria22_contig00033234
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00033234 (376 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAB49423.1| SLL2 [Brassica napus] 56 3e-06 gb|ABB29952.1| SLL2-S9-protein-like [Solanum tuberosum] 56 3e-06 dbj|BAA77395.1| SLL2-S9-protein [Brassica rapa] 56 3e-06 gb|AAO64803.1| At1g66680 [Arabidopsis thaliana] 55 8e-06 ref|NP_176841.1| putative S locus-linked protein [Arabidopsis th... 55 8e-06 >gb|AAB49423.1| SLL2 [Brassica napus] Length = 337 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/39 (64%), Positives = 32/39 (82%) Frame = -1 Query: 376 DLTGTDYSEGAIDLARRLSLRDGFPNIKFLVCFLISISL 260 DLTGTDYSEGA++LA+ LS RDGFPNI+F+V ++ L Sbjct: 183 DLTGTDYSEGAVELAQHLSQRDGFPNIRFMVDDILDTKL 221 >gb|ABB29952.1| SLL2-S9-protein-like [Solanum tuberosum] Length = 240 Score = 55.8 bits (133), Expect = 3e-06 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = -1 Query: 376 DLTGTDYSEGAIDLARRLSLRDGFPNIKFLVCFLISISL 260 DLTGTDYSEGAIDLARRL+ RD F NIKFLV ++ L Sbjct: 182 DLTGTDYSEGAIDLARRLADRDSFTNIKFLVDDILETKL 220 >dbj|BAA77395.1| SLL2-S9-protein [Brassica rapa] Length = 337 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/39 (64%), Positives = 32/39 (82%) Frame = -1 Query: 376 DLTGTDYSEGAIDLARRLSLRDGFPNIKFLVCFLISISL 260 DLTGTDYSEGA++LA+ LS RDGFPNI+F+V ++ L Sbjct: 183 DLTGTDYSEGAVELAQHLSQRDGFPNIRFMVDDILDTKL 221 >gb|AAO64803.1| At1g66680 [Arabidopsis thaliana] Length = 263 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/39 (61%), Positives = 32/39 (82%) Frame = -1 Query: 376 DLTGTDYSEGAIDLARRLSLRDGFPNIKFLVCFLISISL 260 DLTGTDYS+GA++LA+ LS RDGFPNI+F+V ++ L Sbjct: 99 DLTGTDYSDGAVELAQHLSQRDGFPNIRFMVDDILDTKL 137 >ref|NP_176841.1| putative S locus-linked protein [Arabidopsis thaliana] gi|12597759|gb|AAG60072.1|AC013288_6 pheromone receptor, putative (AR401) [Arabidopsis thaliana] gi|332196423|gb|AEE34544.1| putative S locus-linked protein [Arabidopsis thaliana] Length = 358 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/39 (61%), Positives = 32/39 (82%) Frame = -1 Query: 376 DLTGTDYSEGAIDLARRLSLRDGFPNIKFLVCFLISISL 260 DLTGTDYS+GA++LA+ LS RDGFPNI+F+V ++ L Sbjct: 194 DLTGTDYSDGAVELAQHLSQRDGFPNIRFMVDDILDTKL 232