BLASTX nr result
ID: Scutellaria22_contig00033159
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00033159 (272 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002509895.1| Na(+)/H(+) antiporter, putative [Ricinus com... 90 2e-16 ref|XP_002304537.1| cation proton exchanger [Populus trichocarpa... 87 1e-15 ref|XP_002509894.1| Na(+)/H(+) antiporter, putative [Ricinus com... 85 7e-15 ref|XP_002276249.1| PREDICTED: cation/H(+) antiporter 18 [Vitis ... 83 2e-14 emb|CAN81240.1| hypothetical protein VITISV_031075 [Vitis vinifera] 83 2e-14 >ref|XP_002509895.1| Na(+)/H(+) antiporter, putative [Ricinus communis] gi|223549794|gb|EEF51282.1| Na(+)/H(+) antiporter, putative [Ricinus communis] Length = 805 Score = 90.1 bits (222), Expect = 2e-16 Identities = 42/70 (60%), Positives = 55/70 (78%) Frame = -1 Query: 269 VVSNGEELVDVIRTYSRCNLFLVGRMSEGQLVAALNKRSRCSELGPVGNLLISPEFKTTA 90 VV++ E+V+ ++ +SRCNLF+VGRM EG + AALN ++ C ELGP GNLL S +F T+A Sbjct: 711 VVNSAREVVEAVKEFSRCNLFVVGRMPEGPVAAALNGKAECPELGPAGNLLTSHDFTTSA 770 Query: 89 SVLVVQQYRS 60 SVLVVQQY S Sbjct: 771 SVLVVQQYNS 780 >ref|XP_002304537.1| cation proton exchanger [Populus trichocarpa] gi|222841969|gb|EEE79516.1| cation proton exchanger [Populus trichocarpa] Length = 806 Score = 87.4 bits (215), Expect = 1e-15 Identities = 41/70 (58%), Positives = 55/70 (78%) Frame = -1 Query: 269 VVSNGEELVDVIRTYSRCNLFLVGRMSEGQLVAALNKRSRCSELGPVGNLLISPEFKTTA 90 +V+N E V+ + +SRCNLFLVGR+ +G +VA+LN + C ELGPVG+LLISP+F T A Sbjct: 714 IVNNAAETVEAAKDFSRCNLFLVGRVPQGPVVASLNVKVECPELGPVGHLLISPDFTTLA 773 Query: 89 SVLVVQQYRS 60 SVLV+QQ+ S Sbjct: 774 SVLVMQQHAS 783 >ref|XP_002509894.1| Na(+)/H(+) antiporter, putative [Ricinus communis] gi|223549793|gb|EEF51281.1| Na(+)/H(+) antiporter, putative [Ricinus communis] Length = 805 Score = 84.7 bits (208), Expect = 7e-15 Identities = 42/87 (48%), Positives = 56/87 (64%) Frame = -1 Query: 266 VSNGEELVDVIRTYSRCNLFLVGRMSEGQLVAALNKRSRCSELGPVGNLLISPEFKTTAS 87 + N +DVI + CNLFLVGRM EG++ ALN+ + C ELGPVG+LL + F TTAS Sbjct: 715 IRNTAGAMDVIHEVNHCNLFLVGRMPEGEIAIALNRWNECPELGPVGSLLATSNFSTTAS 774 Query: 86 VLVVQQYRSQLTGDSLASLKQDYTSEE 6 VLV+QQY SQ++ D + D + Sbjct: 775 VLVIQQYDSQVSLDLASHAGDDQVGRD 801 >ref|XP_002276249.1| PREDICTED: cation/H(+) antiporter 18 [Vitis vinifera] Length = 787 Score = 83.2 bits (204), Expect = 2e-14 Identities = 40/69 (57%), Positives = 51/69 (73%) Frame = -1 Query: 269 VVSNGEELVDVIRTYSRCNLFLVGRMSEGQLVAALNKRSRCSELGPVGNLLISPEFKTTA 90 VV N E +++IR Y RC +F+VGRM EG +VA L+ ++ ELGPVG+LL SP F T A Sbjct: 706 VVKNAAEAMEIIREYHRCTMFVVGRMPEGHVVAGLSPKTEFPELGPVGSLLTSPGFPTVA 765 Query: 89 SVLVVQQYR 63 SVLVVQQY+ Sbjct: 766 SVLVVQQYQ 774 >emb|CAN81240.1| hypothetical protein VITISV_031075 [Vitis vinifera] Length = 787 Score = 83.2 bits (204), Expect = 2e-14 Identities = 40/69 (57%), Positives = 51/69 (73%) Frame = -1 Query: 269 VVSNGEELVDVIRTYSRCNLFLVGRMSEGQLVAALNKRSRCSELGPVGNLLISPEFKTTA 90 VV N E +++IR Y RC +F+VGRM EG +VA L+ ++ ELGPVG+LL SP F T A Sbjct: 706 VVKNAAEAMEIIREYHRCTMFVVGRMPEGHVVAGLSPKTEFPELGPVGSLLTSPGFPTVA 765 Query: 89 SVLVVQQYR 63 SVLVVQQY+ Sbjct: 766 SVLVVQQYQ 774