BLASTX nr result
ID: Scutellaria22_contig00033120
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00033120 (680 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002512849.1| ATP binding protein, putative [Ricinus commu... 67 4e-09 ref|XP_002303860.1| predicted protein [Populus trichocarpa] gi|2... 66 6e-09 ref|XP_002332066.1| predicted protein [Populus trichocarpa] gi|2... 62 8e-08 ref|XP_003517304.1| PREDICTED: mitogen-activated protein kinase ... 60 5e-07 ref|XP_002866718.1| MAPKKK19 [Arabidopsis lyrata subsp. lyrata] ... 60 5e-07 >ref|XP_002512849.1| ATP binding protein, putative [Ricinus communis] gi|223547860|gb|EEF49352.1| ATP binding protein, putative [Ricinus communis] Length = 320 Score = 66.6 bits (161), Expect = 4e-09 Identities = 32/54 (59%), Positives = 41/54 (75%), Gaps = 2/54 (3%) Frame = +1 Query: 7 MSSKELLRKIGE--DSPKIPDGISKEAKDFLKGCFVRNSKYRLTAEMLLHHPFV 162 M++ ELL KIGE + PK+P ISK+ KDFLK C V+ S +R TAEMLL+HPF+ Sbjct: 236 MTTNELLEKIGECYEPPKMPSQISKDGKDFLKRCLVKKSAFRFTAEMLLNHPFL 289 >ref|XP_002303860.1| predicted protein [Populus trichocarpa] gi|222841292|gb|EEE78839.1| predicted protein [Populus trichocarpa] Length = 278 Score = 66.2 bits (160), Expect = 6e-09 Identities = 33/54 (61%), Positives = 42/54 (77%), Gaps = 2/54 (3%) Frame = +1 Query: 7 MSSKELLRKIGE--DSPKIPDGISKEAKDFLKGCFVRNSKYRLTAEMLLHHPFV 162 ++++ELLRKIG+ + PKIP ISK+AKDFLK CFV N +R TAEMLL PF+ Sbjct: 225 VTTEELLRKIGDGYELPKIPSQISKDAKDFLKRCFVANPMFRFTAEMLLDEPFM 278 >ref|XP_002332066.1| predicted protein [Populus trichocarpa] gi|222831952|gb|EEE70429.1| predicted protein [Populus trichocarpa] Length = 282 Score = 62.4 bits (150), Expect = 8e-08 Identities = 31/51 (60%), Positives = 38/51 (74%), Gaps = 2/51 (3%) Frame = +1 Query: 16 KELLRKIGE--DSPKIPDGISKEAKDFLKGCFVRNSKYRLTAEMLLHHPFV 162 +EL RKIG+ + PK+P +SK+AKDFLK CFV N +R TAEMLL PFV Sbjct: 226 EELKRKIGDGYELPKMPSEVSKDAKDFLKRCFVANPMFRFTAEMLLDEPFV 276 >ref|XP_003517304.1| PREDICTED: mitogen-activated protein kinase kinase kinase 1-like [Glycine max] Length = 346 Score = 59.7 bits (143), Expect = 5e-07 Identities = 26/43 (60%), Positives = 34/43 (79%) Frame = +1 Query: 34 IGEDSPKIPDGISKEAKDFLKGCFVRNSKYRLTAEMLLHHPFV 162 +GE+ PKIP+ +S+E KDFL CFV++ R +AEMLLHHPFV Sbjct: 220 VGEELPKIPEELSEEGKDFLLKCFVKDPMKRWSAEMLLHHPFV 262 >ref|XP_002866718.1| MAPKKK19 [Arabidopsis lyrata subsp. lyrata] gi|297312553|gb|EFH42977.1| MAPKKK19 [Arabidopsis lyrata subsp. lyrata] Length = 344 Score = 59.7 bits (143), Expect = 5e-07 Identities = 25/43 (58%), Positives = 34/43 (79%) Frame = +1 Query: 34 IGEDSPKIPDGISKEAKDFLKGCFVRNSKYRLTAEMLLHHPFV 162 +G++ P IP+ +S++ KDFL CFV++ K R TAEMLLHHPFV Sbjct: 227 VGDELPMIPEELSEQGKDFLSKCFVKDPKKRWTAEMLLHHPFV 269