BLASTX nr result
ID: Scutellaria22_contig00033082
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00033082 (226 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002328907.1| predicted protein [Populus trichocarpa] gi|2... 57 1e-06 >ref|XP_002328907.1| predicted protein [Populus trichocarpa] gi|222839337|gb|EEE77674.1| predicted protein [Populus trichocarpa] Length = 374 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/49 (51%), Positives = 35/49 (71%) Frame = +1 Query: 55 QKMLDIPSEVFREILSRLPAGALLRFRCVSRAWRDTIDDSIFVRSHLRR 201 +K+ +PSE+ EILSRLP L+RF+CVS+ WR I FV++HL+R Sbjct: 3 KKIPKLPSEIISEILSRLPVKCLVRFKCVSKTWRSLISHPEFVKNHLKR 51