BLASTX nr result
ID: Scutellaria22_contig00032337
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00032337 (456 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_187887.3| helicase SWR1 [Arabidopsis thaliana] gi|3098401... 44 1e-05 >ref|NP_187887.3| helicase SWR1 [Arabidopsis thaliana] gi|30984019|gb|AAP40633.1| photoperiod independent early flowering1 [Arabidopsis thaliana] gi|332641727|gb|AEE75248.1| helicase SWR1 [Arabidopsis thaliana] Length = 2055 Score = 43.9 bits (102), Expect(2) = 1e-05 Identities = 26/67 (38%), Positives = 37/67 (55%) Frame = -1 Query: 450 VESEKKQMLHEYNDEQEDDDFVLSAVEENEYDMDDXXXXXXXXXXXXXXXXXXLDEIALL 271 V+S K+ +++NDEQED DFVL+ EE DD ++EIALL Sbjct: 355 VKSRKEDHTYDFNDEQEDVDFVLANGEEK----DDEATLAVEEELAKADNEDHVEEIALL 410 Query: 270 EKENEVP 250 +KE+E+P Sbjct: 411 QKESEMP 417 Score = 30.0 bits (66), Expect(2) = 1e-05 Identities = 20/67 (29%), Positives = 31/67 (46%), Gaps = 2/67 (2%) Frame = -3 Query: 250 LEELLARYKKGCDSEDVEDDFESLSVSGSEEFFDSSEHANSELKHTDD--ETNGFQLDTS 77 +E LLARYK+ +D+ +D S + SE+ S+ + DD + +LD Sbjct: 418 IEVLLARYKEDFGGKDISEDESESSFAVSEDSIVDSDENRQQADLDDDNVDLTECKLDPE 477 Query: 76 PNLEEDE 56 P E E Sbjct: 478 PCSENVE 484