BLASTX nr result
ID: Scutellaria22_contig00032217
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00032217 (220 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002266469.2| PREDICTED: putative pentatricopeptide repeat... 103 2e-20 emb|CBI31172.3| unnamed protein product [Vitis vinifera] 103 2e-20 gb|ADN34022.1| hypothetical protein [Cucumis melo subsp. melo] 99 4e-19 emb|CBI28813.3| unnamed protein product [Vitis vinifera] 97 1e-18 ref|XP_002269269.1| PREDICTED: pentatricopeptide repeat-containi... 97 1e-18 >ref|XP_002266469.2| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330-like [Vitis vinifera] Length = 709 Score = 103 bits (256), Expect = 2e-20 Identities = 44/53 (83%), Positives = 50/53 (94%) Frame = -1 Query: 220 GTTIRVTKNLRVCVDCHTATKYMSEILNREIIVRDNVRFHHFKDGKCSCLDYW 62 GTTIRVTKNLRVCVDCHTATK++S+I+ REI+VRDN RFHHFKDGKCSC D+W Sbjct: 657 GTTIRVTKNLRVCVDCHTATKFISKIVGREIVVRDNSRFHHFKDGKCSCGDFW 709 >emb|CBI31172.3| unnamed protein product [Vitis vinifera] Length = 644 Score = 103 bits (256), Expect = 2e-20 Identities = 44/53 (83%), Positives = 50/53 (94%) Frame = -1 Query: 220 GTTIRVTKNLRVCVDCHTATKYMSEILNREIIVRDNVRFHHFKDGKCSCLDYW 62 GTTIRVTKNLRVCVDCHTATK++S+I+ REI+VRDN RFHHFKDGKCSC D+W Sbjct: 592 GTTIRVTKNLRVCVDCHTATKFISKIVGREIVVRDNSRFHHFKDGKCSCGDFW 644 >gb|ADN34022.1| hypothetical protein [Cucumis melo subsp. melo] Length = 773 Score = 99.0 bits (245), Expect = 4e-19 Identities = 42/53 (79%), Positives = 48/53 (90%) Frame = -1 Query: 220 GTTIRVTKNLRVCVDCHTATKYMSEILNREIIVRDNVRFHHFKDGKCSCLDYW 62 GTTIRVTKNLRVC DCHTATK++S+I+ REI+VRDN RFHHFK+G CSC DYW Sbjct: 721 GTTIRVTKNLRVCTDCHTATKFISKIVGREIVVRDNSRFHHFKNGTCSCGDYW 773 >emb|CBI28813.3| unnamed protein product [Vitis vinifera] Length = 500 Score = 97.4 bits (241), Expect = 1e-18 Identities = 40/53 (75%), Positives = 47/53 (88%) Frame = -1 Query: 220 GTTIRVTKNLRVCVDCHTATKYMSEILNREIIVRDNVRFHHFKDGKCSCLDYW 62 GTTIR+TKNLRVC DCH+ATK +S+I NREIIVRD RFHHF+DG CSC+D+W Sbjct: 448 GTTIRITKNLRVCADCHSATKLISKIYNREIIVRDRCRFHHFRDGSCSCMDFW 500 >ref|XP_002269269.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Vitis vinifera] Length = 640 Score = 97.4 bits (241), Expect = 1e-18 Identities = 40/53 (75%), Positives = 47/53 (88%) Frame = -1 Query: 220 GTTIRVTKNLRVCVDCHTATKYMSEILNREIIVRDNVRFHHFKDGKCSCLDYW 62 GTTIR+TKNLRVC DCH+ATK +S+I NREIIVRD RFHHF+DG CSC+D+W Sbjct: 588 GTTIRITKNLRVCADCHSATKLISKIYNREIIVRDRCRFHHFRDGSCSCMDFW 640