BLASTX nr result
ID: Scutellaria22_contig00032069
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00032069 (295 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI26465.3| unnamed protein product [Vitis vinifera] 68 9e-10 ref|XP_004143732.1| PREDICTED: origin recognition complex subuni... 58 9e-07 ref|XP_002520087.1| origin recognition complex subunit, putative... 58 9e-07 ref|XP_004158149.1| PREDICTED: origin recognition complex subuni... 56 3e-06 >emb|CBI26465.3| unnamed protein product [Vitis vinifera] Length = 4326 Score = 67.8 bits (164), Expect = 9e-10 Identities = 37/78 (47%), Positives = 48/78 (61%) Frame = -1 Query: 292 EPVVKRAIELPSIQRFCQPSTNHIDWASALHELKRLHKLRSSAVMCLYEVGKYRKINLFD 113 E ++K A +LPS +R + A L ELKRL K S+ V+CLYE GKY KI L D Sbjct: 3972 EEMLKYAFDLPSCRRNNTEERTGENLAHDLSELKRLQKCWSTTVLCLYEAGKYNKIQLLD 4031 Query: 112 LYCEMLEPEPLNSSASDH 59 L+CE + P NS+AS+H Sbjct: 4032 LFCEAVVPCLGNSTASNH 4049 >ref|XP_004143732.1| PREDICTED: origin recognition complex subunit 3-like [Cucumis sativus] Length = 737 Score = 57.8 bits (138), Expect = 9e-07 Identities = 34/86 (39%), Positives = 47/86 (54%), Gaps = 3/86 (3%) Frame = -1 Query: 292 EPVVKRAIELPSIQRFCQPSTNHIDWASALHELKRLHKLRSSAVMCLYEVGKYRKINLFD 113 E + K A +L S R+ + + L ELKR K S V+CLY+VGK+ K+ L D Sbjct: 380 EVLPKHASDLLSDSRYSLVEGTDNNLGNILSELKRWRKKWSIVVLCLYQVGKFGKVQLLD 439 Query: 112 LYCEMLEPE---PLNSSASDHMQLEK 44 L CE L+P+ PL S S +Q E+ Sbjct: 440 LLCEALDPQFFKPLTSENSSRLQQEQ 465 >ref|XP_002520087.1| origin recognition complex subunit, putative [Ricinus communis] gi|223540851|gb|EEF42411.1| origin recognition complex subunit, putative [Ricinus communis] Length = 715 Score = 57.8 bits (138), Expect = 9e-07 Identities = 32/69 (46%), Positives = 38/69 (55%) Frame = -1 Query: 292 EPVVKRAIELPSIQRFCQPSTNHIDWASALHELKRLHKLRSSAVMCLYEVGKYRKINLFD 113 E + K A ELPS R N L ELK+L S+ VMCLYE GK K+ L D Sbjct: 384 ENMCKHAFELPSCLRKKMVEQNGDTLVHGLSELKKLCSQWSNIVMCLYEAGKCDKVRLLD 443 Query: 112 LYCEMLEPE 86 L+CE L+PE Sbjct: 444 LFCEALDPE 452 >ref|XP_004158149.1| PREDICTED: origin recognition complex subunit 3-like [Cucumis sativus] Length = 562 Score = 56.2 bits (134), Expect = 3e-06 Identities = 34/86 (39%), Positives = 45/86 (52%), Gaps = 3/86 (3%) Frame = -1 Query: 292 EPVVKRAIELPSIQRFCQPSTNHIDWASALHELKRLHKLRSSAVMCLYEVGKYRKINLFD 113 E + K A L S R+ + + L ELKR K S V CLY+VGK+ K+ L D Sbjct: 380 EVLPKHASHLLSDSRYSLVEGTDNNLGNILSELKRWRKKWSIVVQCLYQVGKFGKVQLLD 439 Query: 112 LYCEMLEPE---PLNSSASDHMQLEK 44 L CE L+P+ PL S S +Q E+ Sbjct: 440 LLCEALDPQFFKPLTSENSSRLQQEQ 465