BLASTX nr result
ID: Scutellaria22_contig00030486
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00030486 (256 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532127.1| leucine-rich repeat containing protein, puta... 55 8e-06 >ref|XP_002532127.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223528186|gb|EEF30247.1| leucine-rich repeat containing protein, putative [Ricinus communis] Length = 1142 Score = 54.7 bits (130), Expect = 8e-06 Identities = 28/85 (32%), Positives = 53/85 (62%), Gaps = 1/85 (1%) Frame = -2 Query: 252 NELLWMSVLEEVNECEGGFVGRYKMNGVFYSLARFITENEFVVLEKGFVRRNLGEVRHVS 73 +EL W S+ ++V + + G + R+KM+ + + LA + E+EF + E + N ++ HV+ Sbjct: 441 SELCWRSLFQDVEKDKLGSIKRFKMHDLIHDLAHSVMEDEFAIAEAESLIVNSRQIHHVT 500 Query: 72 IASDYR-SPLLPEALHQAKHLRSLL 1 + ++ R S +PEAL+ + LR+LL Sbjct: 501 LLTEPRQSFTIPEALYNVESLRTLL 525