BLASTX nr result
ID: Scutellaria22_contig00030453
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00030453 (323 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002297696.1| fasciclin-like arabinogalactan protein famil... 132 3e-29 ref|XP_002282846.1| PREDICTED: fasciclin-like arabinogalactan pr... 125 3e-27 emb|CAN66163.1| hypothetical protein VITISV_008126 [Vitis vinifera] 124 8e-27 ref|XP_002527970.1| conserved hypothetical protein [Ricinus comm... 124 1e-26 ref|XP_004136457.1| PREDICTED: fasciclin-like arabinogalactan pr... 123 1e-26 >ref|XP_002297696.1| fasciclin-like arabinogalactan protein family protein [Populus trichocarpa] gi|222844954|gb|EEE82501.1| fasciclin-like arabinogalactan protein family protein [Populus trichocarpa] Length = 242 Score = 132 bits (332), Expect = 3e-29 Identities = 65/91 (71%), Positives = 79/91 (86%) Frame = -3 Query: 273 NITRILNQYPDYNIFNSYLTQTGIANEINSRQTITVLAVENSNLSPFSGKPLPLMKSILS 94 NIT+IL+QYPD++ F+SYLTQT +A EINSRQTITVL VEN N+SP SGKP +K++LS Sbjct: 10 NITQILSQYPDFSTFSSYLTQTQLAGEINSRQTITVLVVENGNMSPLSGKPNGEIKNVLS 69 Query: 93 VHVILDYFDVQKLQKLTNKSAILTTLFQSTG 1 HVILDY+DV KLQKL NK+A+LTTLFQS+G Sbjct: 70 GHVILDYYDVAKLQKLQNKTAMLTTLFQSSG 100 >ref|XP_002282846.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Vitis vinifera] Length = 305 Score = 125 bits (315), Expect = 3e-27 Identities = 63/105 (60%), Positives = 81/105 (77%) Frame = -3 Query: 315 LFSLLSLVHYASGFNITRILNQYPDYNIFNSYLTQTGIANEINSRQTITVLAVENSNLSP 136 L S L A FNITR+L Q+PD++ FNSYL+QT I+ IN RQTITVLAVEN ++P Sbjct: 15 LSSFLLFSSAAQAFNITRLLGQFPDFSTFNSYLSQTNISIGINRRQTITVLAVENGAIAP 74 Query: 135 FSGKPLPLMKSILSVHVILDYFDVQKLQKLTNKSAILTTLFQSTG 1 +GK + +K+IL +HVILDY+DV KL KL+NK+A+LTTLFQ+TG Sbjct: 75 ITGKSMDDIKNILRLHVILDYYDVAKLHKLSNKTALLTTLFQATG 119 >emb|CAN66163.1| hypothetical protein VITISV_008126 [Vitis vinifera] Length = 305 Score = 124 bits (311), Expect = 8e-27 Identities = 63/105 (60%), Positives = 80/105 (76%) Frame = -3 Query: 315 LFSLLSLVHYASGFNITRILNQYPDYNIFNSYLTQTGIANEINSRQTITVLAVENSNLSP 136 L S L A FNITR+L Q+PD++ FNSYL+QT I+ IN RQTITVLAVEN ++P Sbjct: 15 LSSFLLFSSAAQAFNITRLLGQFPDFSTFNSYLSQTNISIGINKRQTITVLAVENGAIAP 74 Query: 135 FSGKPLPLMKSILSVHVILDYFDVQKLQKLTNKSAILTTLFQSTG 1 + K L +K+IL +HVILDY+DV KL KL+NK+A+LTTLFQ+TG Sbjct: 75 ITXKSLDDIKNILRLHVILDYYDVAKLHKLSNKTALLTTLFQATG 119 >ref|XP_002527970.1| conserved hypothetical protein [Ricinus communis] gi|223532596|gb|EEF34382.1| conserved hypothetical protein [Ricinus communis] Length = 280 Score = 124 bits (310), Expect = 1e-26 Identities = 63/109 (57%), Positives = 83/109 (76%), Gaps = 2/109 (1%) Frame = -3 Query: 321 SLLFSLLSLVHYASG--FNITRILNQYPDYNIFNSYLTQTGIANEINSRQTITVLAVENS 148 SLLF L + ++ FNITRIL+ YPD++ FNS LTQTG+A +INSRQTITVLAV N Sbjct: 7 SLLFLALFCIFSSTSTAFNITRILSNYPDFSTFNSLLTQTGLAQQINSRQTITVLAVSNG 66 Query: 147 NLSPFSGKPLPLMKSILSVHVILDYFDVQKLQKLTNKSAILTTLFQSTG 1 + SGKP+ ++K ILS HVILDY+D +KL+ + +S+ILTTL+Q+TG Sbjct: 67 AIGGVSGKPVDIVKRILSAHVILDYYDQKKLENIKKQSSILTTLYQTTG 115 >ref|XP_004136457.1| PREDICTED: fasciclin-like arabinogalactan protein 14-like [Cucumis sativus] gi|449505538|ref|XP_004162501.1| PREDICTED: fasciclin-like arabinogalactan protein 14-like [Cucumis sativus] Length = 280 Score = 123 bits (309), Expect = 1e-26 Identities = 64/108 (59%), Positives = 87/108 (80%), Gaps = 1/108 (0%) Frame = -3 Query: 321 SLLFSLLSLVHYASGFNITRILNQYPDYNIFNSYLTQTGIANEINSRQTITVLAVENSNL 142 +LLF+ L L AS FNIT++L+Q+PD+ FN LTQT +A++INSR+TIT+LAV+N + Sbjct: 9 ALLFNFL-LFSAASAFNITKLLSQFPDFTNFNDLLTQTKLADDINSRKTITILAVDNGAI 67 Query: 141 SPFSGKPLPLMKSILSVHVILDYFDVQKLQKL-TNKSAILTTLFQSTG 1 S SGKPL +MK ILSVHVILDY+DVQKL KL ++ + +LTTL+Q++G Sbjct: 68 SGISGKPLDVMKRILSVHVILDYYDVQKLGKLSSDNTTVLTTLYQTSG 115