BLASTX nr result
ID: Scutellaria22_contig00030417
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00030417 (713 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002885782.1| hypothetical protein ARALYDRAFT_899310 [Arab... 62 2e-07 >ref|XP_002885782.1| hypothetical protein ARALYDRAFT_899310 [Arabidopsis lyrata subsp. lyrata] gi|297331622|gb|EFH62041.1| hypothetical protein ARALYDRAFT_899310 [Arabidopsis lyrata subsp. lyrata] Length = 279 Score = 61.6 bits (148), Expect = 2e-07 Identities = 31/77 (40%), Positives = 48/77 (62%), Gaps = 2/77 (2%) Frame = +1 Query: 484 YKTWTRPLITSFYVSSLSIGYFSLVFILTVPLLVWPNFTIFWVAMFVGIPAL--VFHLYL 657 +K+W PL+T FY++ +GY L I+ PLLV+ + F VA V + L V+ YL Sbjct: 99 FKSWKGPLVTKFYIALFILGYGFLYAIIFCPLLVFSSKLFFLVAKSVPLLILLEVYESYL 158 Query: 658 IVPWTLSIVVSVVEESY 708 + W LS+V+S++EE+Y Sbjct: 159 AIVWNLSMVISILEETY 175