BLASTX nr result
ID: Scutellaria22_contig00030364
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00030364 (268 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002271033.2| PREDICTED: myb-related protein 315-like [Vit... 110 1e-22 emb|CBI17697.3| unnamed protein product [Vitis vinifera] 110 1e-22 ref|XP_002515013.1| r2r3-myb transcription factor, putative [Ric... 108 5e-22 ref|XP_002526931.1| r2r3-myb transcription factor, putative [Ric... 108 6e-22 ref|XP_002298589.1| predicted protein [Populus trichocarpa] gi|2... 107 1e-21 >ref|XP_002271033.2| PREDICTED: myb-related protein 315-like [Vitis vinifera] Length = 268 Score = 110 bits (275), Expect = 1e-22 Identities = 47/50 (94%), Positives = 49/50 (98%) Frame = +2 Query: 119 MGRQPCCEKIGLKRGPWTIEEDHKLMCFILNNGIQCWRMVPKLAGLLRCG 268 MGRQPCC+K+GLKRGPWTIEEDHKLM FILNNGIQCWRMVPKLAGLLRCG Sbjct: 1 MGRQPCCDKVGLKRGPWTIEEDHKLMSFILNNGIQCWRMVPKLAGLLRCG 50 >emb|CBI17697.3| unnamed protein product [Vitis vinifera] Length = 405 Score = 110 bits (275), Expect = 1e-22 Identities = 47/50 (94%), Positives = 49/50 (98%) Frame = +2 Query: 119 MGRQPCCEKIGLKRGPWTIEEDHKLMCFILNNGIQCWRMVPKLAGLLRCG 268 MGRQPCC+K+GLKRGPWTIEEDHKLM FILNNGIQCWRMVPKLAGLLRCG Sbjct: 1 MGRQPCCDKVGLKRGPWTIEEDHKLMSFILNNGIQCWRMVPKLAGLLRCG 50 >ref|XP_002515013.1| r2r3-myb transcription factor, putative [Ricinus communis] gi|223546064|gb|EEF47567.1| r2r3-myb transcription factor, putative [Ricinus communis] Length = 146 Score = 108 bits (270), Expect = 5e-22 Identities = 46/50 (92%), Positives = 49/50 (98%) Frame = +2 Query: 119 MGRQPCCEKIGLKRGPWTIEEDHKLMCFILNNGIQCWRMVPKLAGLLRCG 268 MGRQPCC+K+GLKRGPWTIEEDHKLM FILNNGIQCWR+VPKLAGLLRCG Sbjct: 1 MGRQPCCDKVGLKRGPWTIEEDHKLMNFILNNGIQCWRLVPKLAGLLRCG 50 >ref|XP_002526931.1| r2r3-myb transcription factor, putative [Ricinus communis] gi|223533683|gb|EEF35418.1| r2r3-myb transcription factor, putative [Ricinus communis] Length = 242 Score = 108 bits (269), Expect = 6e-22 Identities = 47/50 (94%), Positives = 48/50 (96%) Frame = +2 Query: 119 MGRQPCCEKIGLKRGPWTIEEDHKLMCFILNNGIQCWRMVPKLAGLLRCG 268 MGRQPCC+KIGLKRGPWTIEEDHKLM FILNNGI CWRMVPKLAGLLRCG Sbjct: 1 MGRQPCCDKIGLKRGPWTIEEDHKLMNFILNNGIHCWRMVPKLAGLLRCG 50 >ref|XP_002298589.1| predicted protein [Populus trichocarpa] gi|222845847|gb|EEE83394.1| predicted protein [Populus trichocarpa] Length = 282 Score = 107 bits (267), Expect = 1e-21 Identities = 46/50 (92%), Positives = 48/50 (96%) Frame = +2 Query: 119 MGRQPCCEKIGLKRGPWTIEEDHKLMCFILNNGIQCWRMVPKLAGLLRCG 268 MGRQPCC+K+GLKRGPWTIEEDHKL FILNNGIQCWRMVPKLAGLLRCG Sbjct: 1 MGRQPCCDKVGLKRGPWTIEEDHKLTNFILNNGIQCWRMVPKLAGLLRCG 50