BLASTX nr result
ID: Scutellaria22_contig00030296
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00030296 (350 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAA84682.1| unknown protein (chloroplast) [Nicotiana tabacum]... 81 6e-14 ref|XP_002335728.1| predicted protein [Populus trichocarpa] gi|2... 63 2e-08 >gb|AAA84682.1| unknown protein (chloroplast) [Nicotiana tabacum] gi|224352|prf||1102209F ORF 6 Length = 79 Score = 81.3 bits (199), Expect(2) = 6e-14 Identities = 40/51 (78%), Positives = 43/51 (84%), Gaps = 3/51 (5%) Frame = +3 Query: 6 FKTSIIPSRTKHESFDSFGSHAQLLRVNYHRFFYECNEPI---LFIVQKKL 149 F+ SIIPSRTKHESFDSFGSHAQLL+VN H FFYECNEPI LFI QK + Sbjct: 10 FQNSIIPSRTKHESFDSFGSHAQLLKVNSHIFFYECNEPIFSSLFIFQKDI 60 Score = 20.8 bits (42), Expect(2) = 6e-14 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +1 Query: 163 PKYLEDSSD 189 PKY EDSSD Sbjct: 66 PKYSEDSSD 74 >ref|XP_002335728.1| predicted protein [Populus trichocarpa] gi|222834616|gb|EEE73079.1| predicted protein [Populus trichocarpa] Length = 79 Score = 63.2 bits (152), Expect = 2e-08 Identities = 33/46 (71%), Positives = 38/46 (82%), Gaps = 3/46 (6%) Frame = +3 Query: 3 HFKTSIIPSRTKHESFDSFGSHAQLLRV---NYHRFFYECNEPILF 131 H KTS+IPSRTKHESFDSFGSHAQL+++ N H FF + NEPILF Sbjct: 9 HCKTSMIPSRTKHESFDSFGSHAQLVQLLMGNSHLFF-DWNEPILF 53