BLASTX nr result
ID: Scutellaria22_contig00030259
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00030259 (204 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAM61591.1| putative cell differentiation protein [Arabidopsi... 57 1e-06 ref|XP_002885405.1| hypothetical protein ARALYDRAFT_479606 [Arab... 57 2e-06 ref|NP_188716.1| CCR4-NOT transcription complex subunit 9 [Arabi... 57 2e-06 ref|NP_196802.1| Cell differentiation, Rcd1-like protein [Arabid... 55 5e-06 >gb|AAM61591.1| putative cell differentiation protein [Arabidopsis thaliana] Length = 316 Score = 57.4 bits (137), Expect = 1e-06 Identities = 36/60 (60%), Positives = 41/60 (68%), Gaps = 8/60 (13%) Frame = -1 Query: 156 MANLHPSLAMFEL--GSTSSAAN------NKDRNFQSMEQLVLDLCNPDLRENSLLELSK 1 MANL SL+M G ++SA N NKDRN S EQLVLDL NP+LREN+LLELSK Sbjct: 1 MANLPSSLSMSTPFGGPSTSAQNPTGAPANKDRNLASAEQLVLDLSNPELRENALLELSK 60 >ref|XP_002885405.1| hypothetical protein ARALYDRAFT_479606 [Arabidopsis lyrata subsp. lyrata] gi|297331245|gb|EFH61664.1| hypothetical protein ARALYDRAFT_479606 [Arabidopsis lyrata subsp. lyrata] Length = 316 Score = 57.0 bits (136), Expect = 2e-06 Identities = 36/60 (60%), Positives = 41/60 (68%), Gaps = 8/60 (13%) Frame = -1 Query: 156 MANLHPSLAMFEL--GSTSSAAN------NKDRNFQSMEQLVLDLCNPDLRENSLLELSK 1 MANL SL+M G ++SA N NKDRN S EQLVLDL NP+LREN+LLELSK Sbjct: 1 MANLPSSLSMGTPFGGPSTSAQNPSGAPANKDRNLASAEQLVLDLSNPELRENALLELSK 60 >ref|NP_188716.1| CCR4-NOT transcription complex subunit 9 [Arabidopsis thaliana] gi|20258840|gb|AAM13902.1| putative cell differentiation protein [Arabidopsis thaliana] gi|21689729|gb|AAM67486.1| putative cell differentiation protein [Arabidopsis thaliana] gi|332642903|gb|AEE76424.1| CCR4-NOT transcription complex subunit 9 [Arabidopsis thaliana] Length = 316 Score = 57.0 bits (136), Expect = 2e-06 Identities = 36/60 (60%), Positives = 41/60 (68%), Gaps = 8/60 (13%) Frame = -1 Query: 156 MANLHPSLAMFEL--GSTSSAAN------NKDRNFQSMEQLVLDLCNPDLRENSLLELSK 1 MANL SL+M G ++SA N NKDRN S EQLVLDL NP+LREN+LLELSK Sbjct: 1 MANLPSSLSMGTPFGGPSTSAQNPTGAPANKDRNLASAEQLVLDLSNPELRENALLELSK 60 >ref|NP_196802.1| Cell differentiation, Rcd1-like protein [Arabidopsis thaliana] gi|7630054|emb|CAB88262.1| putative protein [Arabidopsis thaliana] gi|28628057|gb|AAO25630.1| phytochrome interacting molecule 1 [Arabidopsis thaliana] gi|332004454|gb|AED91837.1| Cell differentiation, Rcd1-like protein [Arabidopsis thaliana] Length = 311 Score = 55.5 bits (132), Expect = 5e-06 Identities = 30/56 (53%), Positives = 39/56 (69%), Gaps = 4/56 (7%) Frame = -1 Query: 156 MANLHPSLAMFELG----STSSAANNKDRNFQSMEQLVLDLCNPDLRENSLLELSK 1 MANL P L+M + S+ S+++N DR S EQL+LDL NP+LREN+L ELSK Sbjct: 1 MANLPPPLSMKSVALSGASSPSSSSNNDRKLSSAEQLILDLSNPELRENALHELSK 56