BLASTX nr result
ID: Scutellaria22_contig00030040
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00030040 (262 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003551878.1| PREDICTED: mitotic spindle checkpoint protei... 138 4e-31 ref|XP_003631350.1| PREDICTED: mitotic spindle checkpoint protei... 138 5e-31 ref|XP_003538568.1| PREDICTED: mitotic spindle checkpoint protei... 138 5e-31 gb|ACU23607.1| unknown [Glycine max] 138 5e-31 ref|XP_002270903.1| PREDICTED: mitotic spindle checkpoint protei... 138 5e-31 >ref|XP_003551878.1| PREDICTED: mitotic spindle checkpoint protein MAD2-like [Glycine max] Length = 207 Score = 138 bits (348), Expect = 4e-31 Identities = 64/69 (92%), Positives = 66/69 (95%) Frame = +3 Query: 3 SITYLPCLDEPCVFDVLAYTDMDCAVPFTWIESDPKLIANPQMVKLHSFDTKIHKVDTIV 182 SITYLPCLDEPCVFDVLAYTD D AVPFTW+ESDPKLIANPQMVKLHSFDTKIHKVDT+V Sbjct: 138 SITYLPCLDEPCVFDVLAYTDKDVAVPFTWVESDPKLIANPQMVKLHSFDTKIHKVDTLV 197 Query: 183 SYKNDE*DE 209 SYKNDE DE Sbjct: 198 SYKNDEWDE 206 >ref|XP_003631350.1| PREDICTED: mitotic spindle checkpoint protein MAD2 isoform 2 [Vitis vinifera] Length = 211 Score = 138 bits (347), Expect = 5e-31 Identities = 64/69 (92%), Positives = 66/69 (95%) Frame = +3 Query: 3 SITYLPCLDEPCVFDVLAYTDMDCAVPFTWIESDPKLIANPQMVKLHSFDTKIHKVDTIV 182 SITYLPC+DEPCVFDVLAYTD D AVPFTWIESDPKLIANPQMVKLHSFDTKIHKVDT+V Sbjct: 142 SITYLPCIDEPCVFDVLAYTDTDVAVPFTWIESDPKLIANPQMVKLHSFDTKIHKVDTLV 201 Query: 183 SYKNDE*DE 209 SYKNDE DE Sbjct: 202 SYKNDEWDE 210 >ref|XP_003538568.1| PREDICTED: mitotic spindle checkpoint protein MAD2-like [Glycine max] Length = 207 Score = 138 bits (347), Expect = 5e-31 Identities = 63/69 (91%), Positives = 66/69 (95%) Frame = +3 Query: 3 SITYLPCLDEPCVFDVLAYTDMDCAVPFTWIESDPKLIANPQMVKLHSFDTKIHKVDTIV 182 SITYLPCLDEPC+FDVLAYTD D AVPFTW+ESDPKLIANPQMVKLHSFDTKIHKVDT+V Sbjct: 138 SITYLPCLDEPCIFDVLAYTDKDVAVPFTWVESDPKLIANPQMVKLHSFDTKIHKVDTLV 197 Query: 183 SYKNDE*DE 209 SYKNDE DE Sbjct: 198 SYKNDEWDE 206 >gb|ACU23607.1| unknown [Glycine max] Length = 172 Score = 138 bits (347), Expect = 5e-31 Identities = 63/69 (91%), Positives = 66/69 (95%) Frame = +3 Query: 3 SITYLPCLDEPCVFDVLAYTDMDCAVPFTWIESDPKLIANPQMVKLHSFDTKIHKVDTIV 182 SITYLPCLDEPC+FDVLAYTD D AVPFTW+ESDPKLIANPQMVKLHSFDTKIHKVDT+V Sbjct: 103 SITYLPCLDEPCIFDVLAYTDKDVAVPFTWVESDPKLIANPQMVKLHSFDTKIHKVDTLV 162 Query: 183 SYKNDE*DE 209 SYKNDE DE Sbjct: 163 SYKNDEWDE 171 >ref|XP_002270903.1| PREDICTED: mitotic spindle checkpoint protein MAD2 isoform 1 [Vitis vinifera] gi|297738345|emb|CBI27546.3| unnamed protein product [Vitis vinifera] Length = 207 Score = 138 bits (347), Expect = 5e-31 Identities = 64/69 (92%), Positives = 66/69 (95%) Frame = +3 Query: 3 SITYLPCLDEPCVFDVLAYTDMDCAVPFTWIESDPKLIANPQMVKLHSFDTKIHKVDTIV 182 SITYLPC+DEPCVFDVLAYTD D AVPFTWIESDPKLIANPQMVKLHSFDTKIHKVDT+V Sbjct: 138 SITYLPCIDEPCVFDVLAYTDTDVAVPFTWIESDPKLIANPQMVKLHSFDTKIHKVDTLV 197 Query: 183 SYKNDE*DE 209 SYKNDE DE Sbjct: 198 SYKNDEWDE 206