BLASTX nr result
ID: Scutellaria22_contig00030018
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00030018 (547 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_186946.1| heavy-metal-associated domain-containing protei... 56 4e-06 >ref|NP_186946.1| heavy-metal-associated domain-containing protein [Arabidopsis thaliana] gi|6728965|gb|AAF26963.1|AC018363_8 hypothetical protein [Arabidopsis thaliana] gi|332640364|gb|AEE73885.1| heavy-metal-associated domain-containing protein [Arabidopsis thaliana] Length = 246 Score = 55.8 bits (133), Expect = 4e-06 Identities = 31/85 (36%), Positives = 50/85 (58%), Gaps = 3/85 (3%) Frame = +1 Query: 16 CEGCPKILEKKLLKMPGVESVAIYRKENVVLVRGTIKPTSLLNKV-SKLGKSVHLLQ--S 186 CEGC +++ + K+ G++SV R ++ V+VRG + P L+ K+ KLGK LL + Sbjct: 136 CEGCVHEIKRGIEKIKGIQSVEPDRSKSTVVVRGVMDPPKLVEKIKKKLGKHAELLSQIT 195 Query: 187 EKSKDKNCSTNFKVEKEEKHECEAY 261 EK KD N N K E+ + ++ +Y Sbjct: 196 EKGKDNNKKNNNKKEESDGNKIFSY 220