BLASTX nr result
ID: Scutellaria22_contig00029584
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00029584 (317 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001239694.1| dehydration-responsive element-binding prote... 58 7e-07 >ref|NP_001239694.1| dehydration-responsive element-binding protein 3-like [Glycine max] gi|212717190|gb|ACJ37436.1| AP2 domain-containing transcription factor 2 [Glycine max] Length = 188 Score = 58.2 bits (139), Expect = 7e-07 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = -2 Query: 106 EDPPETSKKVKRIREATDSSKHPLYRGVRMRNWGK 2 E PET KK+KRIR DSSKHPLYRGVRMRNWGK Sbjct: 6 ETEPET-KKIKRIRGGGDSSKHPLYRGVRMRNWGK 39