BLASTX nr result
ID: Scutellaria22_contig00029416
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00029416 (417 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003551381.1| PREDICTED: F-box/FBD/LRR-repeat protein At5g... 55 6e-06 >ref|XP_003551381.1| PREDICTED: F-box/FBD/LRR-repeat protein At5g56420-like [Glycine max] Length = 409 Score = 55.1 bits (131), Expect = 6e-06 Identities = 27/50 (54%), Positives = 32/50 (64%) Frame = +2 Query: 254 TEDDDMLSTLPSEIQNQILSILPTSDAAKVGMVSKMWRTTWNAVSKLSFD 403 T DDD +S LP + QILS+LPT A G++SK WR W AVS L FD Sbjct: 16 TGDDDRISHLPDVLLLQILSLLPTKQAVITGILSKRWRPLWPAVSVLDFD 65