BLASTX nr result
ID: Scutellaria22_contig00029233
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00029233 (661 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI26625.3| unnamed protein product [Vitis vinifera] 64 3e-08 >emb|CBI26625.3| unnamed protein product [Vitis vinifera] Length = 194 Score = 63.5 bits (153), Expect = 3e-08 Identities = 32/43 (74%), Positives = 36/43 (83%), Gaps = 1/43 (2%) Frame = -1 Query: 661 TRPMRIGPAANKKPMSAQT-QNGMREALIYGGLELVSAEMIPL 536 TRPMRIGPAA KKP+ Q Q G++EALI GGLEL+SAEMIPL Sbjct: 152 TRPMRIGPAATKKPVGGQQFQKGLQEALILGGLELISAEMIPL 194