BLASTX nr result
ID: Scutellaria22_contig00029136
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00029136 (408 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002274427.1| PREDICTED: pentatricopeptide repeat-containi... 119 2e-25 ref|XP_003535591.1| PREDICTED: pentatricopeptide repeat-containi... 106 2e-21 ref|XP_002513633.1| pentatricopeptide repeat-containing protein,... 106 2e-21 ref|XP_002305943.1| predicted protein [Populus trichocarpa] gi|2... 101 6e-20 ref|XP_003592182.1| Pentatricopeptide repeat-containing protein ... 100 9e-20 >ref|XP_002274427.1| PREDICTED: pentatricopeptide repeat-containing protein At5g52850, chloroplastic [Vitis vinifera] gi|302143764|emb|CBI22625.3| unnamed protein product [Vitis vinifera] Length = 880 Score = 119 bits (299), Expect = 2e-25 Identities = 57/96 (59%), Positives = 73/96 (76%) Frame = +3 Query: 3 QLSHYNLLVDLLGKAGRLEEAVTMLKSSPFSPNASIYKRLLHACKLHQNVLLAEEMVRQG 182 QL HY LVDLLG+AGRLEEA+ ++++ PF P+A IYK LL ACKLH N+ L E M RQG Sbjct: 656 QLDHYVCLVDLLGRAGRLEEAMNVIETMPFKPDALIYKTLLGACKLHGNIPLGEHMARQG 715 Query: 183 LEIDPSDLEFYDLLATIYDEAGRYDLGDNMRSLARK 290 LE+DPSD FY LLA +YD++GR +LG+ R + R+ Sbjct: 716 LELDPSDPAFYVLLANLYDDSGRSELGEKTRRMMRE 751 >ref|XP_003535591.1| PREDICTED: pentatricopeptide repeat-containing protein At5g52850, chloroplastic-like [Glycine max] Length = 903 Score = 106 bits (265), Expect = 2e-21 Identities = 54/102 (52%), Positives = 70/102 (68%) Frame = +3 Query: 3 QLSHYNLLVDLLGKAGRLEEAVTMLKSSPFSPNASIYKRLLHACKLHQNVLLAEEMVRQG 182 +L HY LVDLLG+ GRLEEA+ ++++ PF P++ IYK LL+AC LH NV L E+M R+ Sbjct: 659 KLDHYVCLVDLLGRGGRLEEAMGVIETMPFKPDSVIYKTLLNACNLHGNVPLGEDMARRC 718 Query: 183 LEIDPSDLEFYDLLATIYDEAGRYDLGDNMRSLARKNLLSSS 308 LE+DP D Y LLA++YD AG D GD R L R+ L S Sbjct: 719 LELDPCDPAIYLLLASLYDNAGLPDFGDKTRKLMRERGLRRS 760 >ref|XP_002513633.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223547541|gb|EEF49036.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 777 Score = 106 bits (265), Expect = 2e-21 Identities = 51/105 (48%), Positives = 75/105 (71%), Gaps = 1/105 (0%) Frame = +3 Query: 3 QLSHYNLLVDLLGKAGRLEEAVTMLKSSPFSPNASIYKRLLHACKLHQNVLLAEEMVRQG 182 Q HY LVD+LG+AGRLEEA+ ++++ P P+ASIYK LL AC +H+N+ L E++ R+G Sbjct: 660 QSDHYVCLVDILGRAGRLEEAMNIIETMPLEPDASIYKTLLAACSIHRNMNLGEDVARRG 719 Query: 183 LEIDPSDLEFYDLLATIYDEAGRYDLGD-NMRSLARKNLLSSSKV 314 LE++P D F+ LL +YD+ GRYDLG+ RS+ +K + +V Sbjct: 720 LELNPLDPAFHLLLVKLYDDCGRYDLGEKTRRSIKQKGWTAMGRV 764 >ref|XP_002305943.1| predicted protein [Populus trichocarpa] gi|222848907|gb|EEE86454.1| predicted protein [Populus trichocarpa] Length = 693 Score = 101 bits (252), Expect = 6e-20 Identities = 51/95 (53%), Positives = 67/95 (70%) Frame = +3 Query: 3 QLSHYNLLVDLLGKAGRLEEAVTMLKSSPFSPNASIYKRLLHACKLHQNVLLAEEMVRQG 182 QL HY L DLLG+AGRLEEA+ +L++ P PNASIYK LL ACK+H+ V L E++ +G Sbjct: 581 QLDHYVCLFDLLGRAGRLEEAMEILETMPIRPNASIYKTLLAACKVHRIVPLGEDIASRG 640 Query: 183 LEIDPSDLEFYDLLATIYDEAGRYDLGDNMRSLAR 287 L++DPSD F +LA +YD +GR DL +R R Sbjct: 641 LKLDPSDPAFNLMLANLYDSSGRPDLAATIRRSVR 675 >ref|XP_003592182.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355481230|gb|AES62433.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 912 Score = 100 bits (250), Expect = 9e-20 Identities = 52/102 (50%), Positives = 67/102 (65%) Frame = +3 Query: 3 QLSHYNLLVDLLGKAGRLEEAVTMLKSSPFSPNASIYKRLLHACKLHQNVLLAEEMVRQG 182 +L HY LVDLLG+ GRLEEA+ +++ F P++ I K LL+AC LH NV L E+M R+ Sbjct: 657 KLDHYMCLVDLLGRGGRLEEAMGVIEKMSFKPDSLICKTLLNACNLHGNVALGEDMARRC 716 Query: 183 LEIDPSDLEFYDLLATIYDEAGRYDLGDNMRSLARKNLLSSS 308 LE+DPSD Y LLA +YD AG D G+ R L R+ L S Sbjct: 717 LELDPSDPAIYLLLANLYDNAGLSDFGEKTRRLMRERGLRRS 758