BLASTX nr result
ID: Scutellaria22_contig00028581
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00028581 (350 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004138258.1| PREDICTED: putative FBD-associated F-box pro... 77 1e-12 ref|XP_002511355.1| ubiquitin-protein ligase, putative [Ricinus ... 70 1e-10 ref|XP_002513467.1| ubiquitin-protein ligase, putative [Ricinus ... 69 3e-10 ref|NP_191447.1| putative F-box/LRR-repeat protein [Arabidopsis ... 68 9e-10 ref|NP_001030886.1| F-box/LRR-repeat protein [Arabidopsis thalia... 67 1e-09 >ref|XP_004138258.1| PREDICTED: putative FBD-associated F-box protein At5g56700-like [Cucumis sativus] gi|449501454|ref|XP_004161371.1| PREDICTED: putative FBD-associated F-box protein At5g56700-like [Cucumis sativus] Length = 475 Score = 77.4 bits (189), Expect = 1e-12 Identities = 42/114 (36%), Positives = 67/114 (58%) Frame = -3 Query: 342 LFSSQIAYTDMEEARSSQSNEGMQNSIDQLPDEVLISIVSLLSVKEAVRTSVLARRWRYF 163 L S++ EE + + + + +SI LP ++L+ I+SLL +KEA RTS L+ +WR Sbjct: 22 LISTEELCLPFEEPENERCDRSV-DSISHLPQDILVFILSLLPLKEAARTSTLSHKWRCL 80 Query: 162 WVFDPILVFDGSEMVHKLEIRRKVLESERIKFVGSVNRVLDLHSRETIDEFRLR 1 W F P L FD + + L+ + L+SER +FV VNRV+D + ++ R+R Sbjct: 81 WSFIPCLNFDAHKKLLDLQFTDENLKSERRQFVKWVNRVIDSYKGSNLETLRIR 134 >ref|XP_002511355.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223550470|gb|EEF51957.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 457 Score = 70.5 bits (171), Expect = 1e-10 Identities = 40/93 (43%), Positives = 57/93 (61%), Gaps = 2/93 (2%) Frame = -3 Query: 282 EGMQNSIDQLPDEVLISIVSLLSVKEAVRTSVLARRWRYFWVFDPILVFDGSEMV--HKL 109 E ++ I LP+E+L SI+S L+ +EA RTSVL+RRWR W L FD +++ KL Sbjct: 15 EAKEDRISHLPEEILTSILSFLTTEEASRTSVLSRRWRILWTLTSSLNFDCTKIALGKKL 74 Query: 108 EIRRKVLESERIKFVGSVNRVLDLHSRETIDEF 10 + R L SER +F V RVL+++ +DEF Sbjct: 75 D-DRFALRSERTRFAMWVKRVLEVYKDSNLDEF 106 >ref|XP_002513467.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223547375|gb|EEF48870.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 464 Score = 69.3 bits (168), Expect = 3e-10 Identities = 39/97 (40%), Positives = 60/97 (61%), Gaps = 3/97 (3%) Frame = -3 Query: 285 NEGMQNSIDQLPDEVLISIVSLLSVKEAVRTSVLARRWRYFWV-FDPILVFDGSEMVHKL 109 N + I QLP++VL++I+S L++KEA RTS+L+ RWR+ W + I+ FD S + L Sbjct: 28 NGNISEHISQLPEDVLLNILSRLTMKEAARTSILSTRWRHLWTYYTGIMDFDASLTMWYL 87 Query: 108 E--IRRKVLESERIKFVGSVNRVLDLHSRETIDEFRL 4 + + K L+ ER FV VN+VL H T++ R+ Sbjct: 88 QLGLGSKSLDMERHSFVSWVNQVLRSHEGPTMEGLRI 124 >ref|NP_191447.1| putative F-box/LRR-repeat protein [Arabidopsis thaliana] gi|75264354|sp|Q9LXR4.1|FBL56_ARATH RecName: Full=Putative F-box/LRR-repeat protein At3g58880 gi|7630083|emb|CAB88305.1| putative protein [Arabidopsis thaliana] gi|332646322|gb|AEE79843.1| putative F-box/LRR-repeat protein [Arabidopsis thaliana] Length = 454 Score = 67.8 bits (164), Expect = 9e-10 Identities = 38/92 (41%), Positives = 55/92 (59%) Frame = -3 Query: 276 MQNSIDQLPDEVLISIVSLLSVKEAVRTSVLARRWRYFWVFDPILVFDGSEMVHKLEIRR 97 M + + LPD++L I+SLL+ KEA TS+L++RWRY F P L FD S ++ E + Sbjct: 1 MVDLVSSLPDDLLGHILSLLTTKEAALTSILSKRWRYLIAFVPYLEFDDSAFLNP-EEGK 59 Query: 96 KVLESERIKFVGSVNRVLDLHSRETIDEFRLR 1 + E R F+ V+RVL LH I +F L+ Sbjct: 60 QTREGTRQSFIDFVDRVLALHGDSPIRKFSLK 91 >ref|NP_001030886.1| F-box/LRR-repeat protein [Arabidopsis thaliana] gi|332646326|gb|AEE79847.1| F-box/LRR-repeat protein [Arabidopsis thaliana] Length = 314 Score = 67.4 bits (163), Expect = 1e-09 Identities = 39/85 (45%), Positives = 51/85 (60%) Frame = -3 Query: 255 LPDEVLISIVSLLSVKEAVRTSVLARRWRYFWVFDPILVFDGSEMVHKLEIRRKVLESER 76 LP+E+L I+S LS KEA TSVL++RWR + F P L FD S +H E R++ E Sbjct: 7 LPNELLYHILSFLSTKEAALTSVLSKRWRNLFAFVPYLEFDDSVFLHP-EERKREKEGIL 65 Query: 75 IKFVGSVNRVLDLHSRETIDEFRLR 1 F+ V+RVLDLH I F L+ Sbjct: 66 QSFMDFVDRVLDLHGDSLIKTFSLK 90