BLASTX nr result
ID: Scutellaria22_contig00027461
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00027461 (274 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004163558.1| PREDICTED: probable sodium-coupled neutral a... 60 2e-07 emb|CBI36435.3| unnamed protein product [Vitis vinifera] 58 9e-07 ref|XP_002268792.1| PREDICTED: sodium-coupled neutral amino acid... 58 9e-07 emb|CAN77569.1| hypothetical protein VITISV_036714 [Vitis vinifera] 58 9e-07 ref|NP_565239.1| transmembrane amino acid transporter-like prote... 57 1e-06 >ref|XP_004163558.1| PREDICTED: probable sodium-coupled neutral amino acid transporter 6-like [Cucumis sativus] Length = 490 Score = 59.7 bits (143), Expect = 2e-07 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = +3 Query: 126 PLIFGERKSGSGISGAVFNLTTSIIGAGIMALPATMK 236 PLI GE + S ISGAVFNLTTSIIGAGIMALPATMK Sbjct: 64 PLITGEPRGESRISGAVFNLTTSIIGAGIMALPATMK 100 >emb|CBI36435.3| unnamed protein product [Vitis vinifera] Length = 465 Score = 57.8 bits (138), Expect = 9e-07 Identities = 32/39 (82%), Positives = 34/39 (87%), Gaps = 2/39 (5%) Frame = +3 Query: 126 PLIFGERKS--GSGISGAVFNLTTSIIGAGIMALPATMK 236 PL+ G +S GSGISGAVFNLTTSIIGAGIMALPATMK Sbjct: 43 PLMDGGVRSNKGSGISGAVFNLTTSIIGAGIMALPATMK 81 >ref|XP_002268792.1| PREDICTED: sodium-coupled neutral amino acid transporter 4 [Vitis vinifera] Length = 494 Score = 57.8 bits (138), Expect = 9e-07 Identities = 32/39 (82%), Positives = 34/39 (87%), Gaps = 2/39 (5%) Frame = +3 Query: 126 PLIFGERKS--GSGISGAVFNLTTSIIGAGIMALPATMK 236 PL+ G +S GSGISGAVFNLTTSIIGAGIMALPATMK Sbjct: 68 PLMDGGVRSNKGSGISGAVFNLTTSIIGAGIMALPATMK 106 >emb|CAN77569.1| hypothetical protein VITISV_036714 [Vitis vinifera] Length = 562 Score = 57.8 bits (138), Expect = 9e-07 Identities = 32/39 (82%), Positives = 34/39 (87%), Gaps = 2/39 (5%) Frame = +3 Query: 126 PLIFGERKS--GSGISGAVFNLTTSIIGAGIMALPATMK 236 PL+ G +S GSGISGAVFNLTTSIIGAGIMALPATMK Sbjct: 136 PLMDGGVRSNKGSGISGAVFNLTTSIIGAGIMALPATMK 174 >ref|NP_565239.1| transmembrane amino acid transporter-like protein [Arabidopsis thaliana] gi|6730737|gb|AAF27127.1|AC018849_15 hypothetical protein; 45530-44061 [Arabidopsis thaliana] gi|16226719|gb|AAL16241.1|AF428472_1 At1g80510/T21F11_16 [Arabidopsis thaliana] gi|23506157|gb|AAN31090.1| At1g80510/T21F11_16 [Arabidopsis thaliana] gi|332198293|gb|AEE36414.1| transmembrane amino acid transporter-like protein [Arabidopsis thaliana] Length = 489 Score = 57.4 bits (137), Expect = 1e-06 Identities = 30/38 (78%), Positives = 33/38 (86%), Gaps = 1/38 (2%) Frame = +3 Query: 126 PLIFGERKS-GSGISGAVFNLTTSIIGAGIMALPATMK 236 PL+ G+ + GSGI GAVFNLTTSIIGAGIMALPATMK Sbjct: 64 PLVHGKSSNQGSGIYGAVFNLTTSIIGAGIMALPATMK 101