BLASTX nr result
ID: Scutellaria22_contig00027425
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00027425 (402 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531502.1| conserved hypothetical protein [Ricinus comm... 67 2e-09 ref|XP_002308904.1| predicted protein [Populus trichocarpa] gi|2... 67 2e-09 ref|XP_002871075.1| hypothetical protein ARALYDRAFT_908293 [Arab... 65 8e-09 emb|CBI30080.3| unnamed protein product [Vitis vinifera] 65 8e-09 ref|NP_196028.2| uncharacterized protein [Arabidopsis thaliana] ... 65 8e-09 >ref|XP_002531502.1| conserved hypothetical protein [Ricinus communis] gi|223528889|gb|EEF30889.1| conserved hypothetical protein [Ricinus communis] Length = 56 Score = 67.0 bits (162), Expect = 2e-09 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +3 Query: 120 KMKWWPRTKPKGERGFLEGCLFALCCCWLCEVCF 221 K K P TK KG+RGF+EGCLFALCCCWLCE CF Sbjct: 23 KKKCCPNTKKKGDRGFIEGCLFALCCCWLCEACF 56 >ref|XP_002308904.1| predicted protein [Populus trichocarpa] gi|222854880|gb|EEE92427.1| predicted protein [Populus trichocarpa] Length = 56 Score = 67.0 bits (162), Expect = 2e-09 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +3 Query: 126 KWWPRTKPKGERGFLEGCLFALCCCWLCEVC 218 K +PRTK KGERGF+EGCLFALCCCW+CE+C Sbjct: 25 KCFPRTKKKGERGFIEGCLFALCCCWICEMC 55 >ref|XP_002871075.1| hypothetical protein ARALYDRAFT_908293 [Arabidopsis lyrata subsp. lyrata] gi|297316912|gb|EFH47334.1| hypothetical protein ARALYDRAFT_908293 [Arabidopsis lyrata subsp. lyrata] Length = 64 Score = 64.7 bits (156), Expect = 8e-09 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +3 Query: 114 KKKMKWWPRTKPKGERGFLEGCLFALCCCWLCEVCF 221 KKK + TK KG+RGF+EGCLFALCCCW+CE+CF Sbjct: 29 KKKKPRFFETKKKGDRGFIEGCLFALCCCWICEMCF 64 >emb|CBI30080.3| unnamed protein product [Vitis vinifera] Length = 56 Score = 64.7 bits (156), Expect = 8e-09 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = +3 Query: 135 PRTKPKGERGFLEGCLFALCCCWLCEVCF 221 PR+K KG+RGF+EGCLFALCCCW+CE CF Sbjct: 28 PRSKSKGDRGFIEGCLFALCCCWICEACF 56 >ref|NP_196028.2| uncharacterized protein [Arabidopsis thaliana] gi|38603900|gb|AAR24695.1| At5g04080 [Arabidopsis thaliana] gi|41349906|gb|AAS00338.1| At5g04080 [Arabidopsis thaliana] gi|332003311|gb|AED90694.1| uncharacterized protein [Arabidopsis thaliana] Length = 63 Score = 64.7 bits (156), Expect = 8e-09 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +3 Query: 114 KKKMKWWPRTKPKGERGFLEGCLFALCCCWLCEVCF 221 KKK + TK KG+RGF+EGCLFALCCCW+CE+CF Sbjct: 28 KKKKPRFFETKQKGDRGFIEGCLFALCCCWICEMCF 63