BLASTX nr result
ID: Scutellaria22_contig00026979
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00026979 (287 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514085.1| conserved hypothetical protein [Ricinus comm... 77 1e-12 ref|XP_002309200.1| predicted protein [Populus trichocarpa] gi|2... 75 4e-12 ref|NP_197561.1| uncharacterized protein [Arabidopsis thaliana] ... 67 1e-09 ref|XP_002871949.1| hypothetical protein ARALYDRAFT_488965 [Arab... 67 1e-09 emb|CBI27862.3| unnamed protein product [Vitis vinifera] 67 1e-09 >ref|XP_002514085.1| conserved hypothetical protein [Ricinus communis] gi|223546541|gb|EEF48039.1| conserved hypothetical protein [Ricinus communis] Length = 1120 Score = 77.0 bits (188), Expect = 1e-12 Identities = 32/49 (65%), Positives = 39/49 (79%) Frame = +2 Query: 140 SIWSWKRLKALTGSRSRKINCCFSLLVHSIEGLPPVFDGVCMVVHWKRR 286 SIW+WK LKAL+ RSRK NCCFS+ VH+IEG PP F+ + + VHWKRR Sbjct: 83 SIWNWKPLKALSNVRSRKFNCCFSVQVHTIEGFPPSFENLSICVHWKRR 131 >ref|XP_002309200.1| predicted protein [Populus trichocarpa] gi|222855176|gb|EEE92723.1| predicted protein [Populus trichocarpa] Length = 1122 Score = 75.5 bits (184), Expect = 4e-12 Identities = 31/49 (63%), Positives = 38/49 (77%) Frame = +2 Query: 140 SIWSWKRLKALTGSRSRKINCCFSLLVHSIEGLPPVFDGVCMVVHWKRR 286 SIW+WK LKA + +R+R+ NCCFSL VHSIEG P FD + + VHWKRR Sbjct: 82 SIWNWKPLKAFSNARNREFNCCFSLQVHSIEGFPSTFDNLSVCVHWKRR 130 >ref|NP_197561.1| uncharacterized protein [Arabidopsis thaliana] gi|332005483|gb|AED92866.1| uncharacterized protein [Arabidopsis thaliana] Length = 1164 Score = 67.4 bits (163), Expect = 1e-09 Identities = 28/49 (57%), Positives = 36/49 (73%) Frame = +2 Query: 140 SIWSWKRLKALTGSRSRKINCCFSLLVHSIEGLPPVFDGVCMVVHWKRR 286 S W+W L+A+ R+R+ NCCFS VHSIEGLPP+F + + VHWKRR Sbjct: 60 SFWNWP-LRAINHVRNRRFNCCFSAQVHSIEGLPPIFQDLSLTVHWKRR 107 >ref|XP_002871949.1| hypothetical protein ARALYDRAFT_488965 [Arabidopsis lyrata subsp. lyrata] gi|297317786|gb|EFH48208.1| hypothetical protein ARALYDRAFT_488965 [Arabidopsis lyrata subsp. lyrata] Length = 1147 Score = 67.4 bits (163), Expect = 1e-09 Identities = 28/49 (57%), Positives = 36/49 (73%) Frame = +2 Query: 140 SIWSWKRLKALTGSRSRKINCCFSLLVHSIEGLPPVFDGVCMVVHWKRR 286 S W+W L+A+ R+R+ NCCFS VHSIEGLPP+F + + VHWKRR Sbjct: 61 SFWNWP-LRAINHVRNRRFNCCFSAQVHSIEGLPPIFQDLSLTVHWKRR 108 >emb|CBI27862.3| unnamed protein product [Vitis vinifera] Length = 834 Score = 67.4 bits (163), Expect = 1e-09 Identities = 29/49 (59%), Positives = 36/49 (73%) Frame = +2 Query: 140 SIWSWKRLKALTGSRSRKINCCFSLLVHSIEGLPPVFDGVCMVVHWKRR 286 SIWSWK LK+L+ R+R+ NCCFSL VH IEGLP + + VHWKR+ Sbjct: 103 SIWSWKALKSLSHIRNRRFNCCFSLHVHLIEGLPSNLNDSSLTVHWKRK 151