BLASTX nr result
ID: Scutellaria22_contig00026970
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00026970 (346 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AET22504.1| hypothetical protein [Solanum lycopersicum] gi|35... 64 1e-08 gb|AET22503.1| hypothetical protein [Solanum lycopersicum] 64 1e-08 >gb|AET22504.1| hypothetical protein [Solanum lycopersicum] gi|356600308|gb|AET22505.1| hypothetical protein [Solanum pimpinellifolium] Length = 886 Score = 64.3 bits (155), Expect = 1e-08 Identities = 34/87 (39%), Positives = 49/87 (56%), Gaps = 2/87 (2%) Frame = +3 Query: 12 CFGLKLLKKFDAVNIRFYKFPXXXXXXXXXXYLAITCNASLPSSISKLRKLQYLIVHRHL 191 C G KLL+ D VN FY FP YLA++ N+ LP SISKL+ LQ LI++ Sbjct: 557 CMGFKLLRVLDVVNYSFYGFPIHVIKLVHLRYLALSINSELPRSISKLKSLQTLIIY--- 613 Query: 192 IMKFGAPS--YLPVEIWDMKTLKYLYI 266 +G LP+E+W M L+++++ Sbjct: 614 ---WGTKEMRILPLELWKMPILRHIHV 637 >gb|AET22503.1| hypothetical protein [Solanum lycopersicum] Length = 888 Score = 64.3 bits (155), Expect = 1e-08 Identities = 34/87 (39%), Positives = 49/87 (56%), Gaps = 2/87 (2%) Frame = +3 Query: 12 CFGLKLLKKFDAVNIRFYKFPXXXXXXXXXXYLAITCNASLPSSISKLRKLQYLIVHRHL 191 C G KLL+ D VN FY FP YLA++ N+ LP SISKL+ LQ LI++ Sbjct: 559 CIGFKLLRVLDVVNYSFYGFPIHVIKLVHLRYLALSINSELPRSISKLKSLQTLIIY--- 615 Query: 192 IMKFGAPS--YLPVEIWDMKTLKYLYI 266 +G LP+E+W M L+++++ Sbjct: 616 ---WGTKEMRILPLELWKMPILRHIHV 639