BLASTX nr result
ID: Scutellaria22_contig00026882
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00026882 (309 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002272922.1| PREDICTED: uncharacterized protein LOC100265... 75 4e-12 ref|XP_004171348.1| PREDICTED: uncharacterized LOC101205379 [Cuc... 72 6e-11 ref|XP_004150211.1| PREDICTED: uncharacterized protein LOC101205... 72 6e-11 ref|XP_004134660.1| PREDICTED: uncharacterized protein LOC101214... 72 6e-11 ref|XP_002522585.1| conserved hypothetical protein [Ricinus comm... 69 3e-10 >ref|XP_002272922.1| PREDICTED: uncharacterized protein LOC100265230 [Vitis vinifera] Length = 182 Score = 75.5 bits (184), Expect = 4e-12 Identities = 39/46 (84%), Positives = 41/46 (89%), Gaps = 3/46 (6%) Frame = +1 Query: 82 ISVANLLISDRYLTEILSEKIST---RRRGRVGVWRPHLESICETP 210 IS+ NLLISDRYL+EILSEKIST RRRGRVGVWRPHLESI ETP Sbjct: 134 ISMTNLLISDRYLSEILSEKISTQRDRRRGRVGVWRPHLESISETP 179 >ref|XP_004171348.1| PREDICTED: uncharacterized LOC101205379 [Cucumis sativus] Length = 278 Score = 71.6 bits (174), Expect = 6e-11 Identities = 34/47 (72%), Positives = 41/47 (87%), Gaps = 3/47 (6%) Frame = +1 Query: 79 NISVANLLISDRYLTEILSEKIST---RRRGRVGVWRPHLESICETP 210 +IS+ NLL+SD YL+EILS+K ST RRRGRVGVWRPHL+SICE+P Sbjct: 229 SISMTNLLVSDHYLSEILSDKASTHRERRRGRVGVWRPHLQSICESP 275 >ref|XP_004150211.1| PREDICTED: uncharacterized protein LOC101205379 [Cucumis sativus] Length = 180 Score = 71.6 bits (174), Expect = 6e-11 Identities = 34/47 (72%), Positives = 41/47 (87%), Gaps = 3/47 (6%) Frame = +1 Query: 79 NISVANLLISDRYLTEILSEKIST---RRRGRVGVWRPHLESICETP 210 +IS+ NLL+SD YL+EILS+K ST RRRGRVGVWRPHL+SICE+P Sbjct: 131 SISMTNLLVSDHYLSEILSDKASTHRERRRGRVGVWRPHLQSICESP 177 >ref|XP_004134660.1| PREDICTED: uncharacterized protein LOC101214777 [Cucumis sativus] gi|449479227|ref|XP_004155541.1| PREDICTED: uncharacterized protein LOC101227724 [Cucumis sativus] Length = 167 Score = 71.6 bits (174), Expect = 6e-11 Identities = 35/52 (67%), Positives = 42/52 (80%), Gaps = 4/52 (7%) Frame = +1 Query: 73 GCNISVANLLISDRYLTEILSEKIST----RRRGRVGVWRPHLESICETPVE 216 G ISV NL++SDRYL+EILSEK++T +RRGRVGVWRPHLESI E P + Sbjct: 115 GSGISVTNLVVSDRYLSEILSEKLTTVQKDKRRGRVGVWRPHLESISEFPTD 166 >ref|XP_002522585.1| conserved hypothetical protein [Ricinus communis] gi|223538276|gb|EEF39885.1| conserved hypothetical protein [Ricinus communis] Length = 197 Score = 69.3 bits (168), Expect = 3e-10 Identities = 36/41 (87%), Positives = 37/41 (90%), Gaps = 3/41 (7%) Frame = +1 Query: 94 NLLISDRYLTEILSEKIST---RRRGRVGVWRPHLESICET 207 NLLISDRYL+EILSEKIST RRRGRVGVWRPHLESI ET Sbjct: 153 NLLISDRYLSEILSEKISTQRDRRRGRVGVWRPHLESISET 193