BLASTX nr result
ID: Scutellaria22_contig00026732
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00026732 (261 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004139639.1| PREDICTED: vacuolar protein sorting-associat... 92 3e-17 ref|XP_002302763.1| predicted protein [Populus trichocarpa] gi|2... 92 3e-17 ref|XP_002515286.1| conserved hypothetical protein [Ricinus comm... 91 8e-17 ref|NP_001190654.1| Vps51/Vps67 family (components of vesicular ... 91 1e-16 ref|XP_003591408.1| Fat-free-like protein [Medicago truncatula] ... 90 2e-16 >ref|XP_004139639.1| PREDICTED: vacuolar protein sorting-associated protein 51 homolog [Cucumis sativus] gi|449475454|ref|XP_004154458.1| PREDICTED: vacuolar protein sorting-associated protein 51 homolog [Cucumis sativus] Length = 782 Score = 92.4 bits (228), Expect = 3e-17 Identities = 45/47 (95%), Positives = 47/47 (100%) Frame = -3 Query: 241 VQKSNLEGLLQKHVEMAAEIKNLDTDLQMLVYENYNKFISATDTIKK 101 VQKSNLEGLLQ+HVEMAAEIKNLDTDLQMLVYENYNKFISATDTIK+ Sbjct: 62 VQKSNLEGLLQRHVEMAAEIKNLDTDLQMLVYENYNKFISATDTIKR 108 >ref|XP_002302763.1| predicted protein [Populus trichocarpa] gi|222844489|gb|EEE82036.1| predicted protein [Populus trichocarpa] Length = 294 Score = 92.4 bits (228), Expect = 3e-17 Identities = 45/47 (95%), Positives = 47/47 (100%) Frame = -3 Query: 241 VQKSNLEGLLQKHVEMAAEIKNLDTDLQMLVYENYNKFISATDTIKK 101 VQ+SNLEGLLQKHVEMAAEIKNLDTDLQMLVYENYNKFISATDTIK+ Sbjct: 59 VQRSNLEGLLQKHVEMAAEIKNLDTDLQMLVYENYNKFISATDTIKR 105 >ref|XP_002515286.1| conserved hypothetical protein [Ricinus communis] gi|223545766|gb|EEF47270.1| conserved hypothetical protein [Ricinus communis] Length = 783 Score = 91.3 bits (225), Expect = 8e-17 Identities = 44/47 (93%), Positives = 47/47 (100%) Frame = -3 Query: 241 VQKSNLEGLLQKHVEMAAEIKNLDTDLQMLVYENYNKFISATDTIKK 101 +QK+NLEGLLQKHVEMAAEIKNLDTDLQMLVYENYNKFISATDTIK+ Sbjct: 58 LQKANLEGLLQKHVEMAAEIKNLDTDLQMLVYENYNKFISATDTIKR 104 >ref|NP_001190654.1| Vps51/Vps67 family (components of vesicular transport) protein [Arabidopsis thaliana] gi|332656714|gb|AEE82114.1| Vps51/Vps67 family (components of vesicular transport) protein [Arabidopsis thaliana] Length = 805 Score = 90.5 bits (223), Expect = 1e-16 Identities = 42/51 (82%), Positives = 49/51 (96%) Frame = -3 Query: 253 WLQKVQKSNLEGLLQKHVEMAAEIKNLDTDLQMLVYENYNKFISATDTIKK 101 W+ +++KSNLE LLQ+HV+MAAEIKNLDTDLQMLVYENYNKFISATDTIK+ Sbjct: 79 WVYEIKKSNLEVLLQRHVQMAAEIKNLDTDLQMLVYENYNKFISATDTIKR 129 >ref|XP_003591408.1| Fat-free-like protein [Medicago truncatula] gi|355480456|gb|AES61659.1| Fat-free-like protein [Medicago truncatula] Length = 758 Score = 90.1 bits (222), Expect = 2e-16 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 241 VQKSNLEGLLQKHVEMAAEIKNLDTDLQMLVYENYNKFISATDTIKK 101 V KSNLEGLLQ+HVEMAAEIKNLDTDLQMLVYENYNKFISATDTIK+ Sbjct: 62 VYKSNLEGLLQRHVEMAAEIKNLDTDLQMLVYENYNKFISATDTIKR 108