BLASTX nr result
ID: Scutellaria22_contig00026635
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00026635 (308 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519186.1| conserved hypothetical protein [Ricinus comm... 58 9e-07 ref|XP_002314925.1| predicted protein [Populus trichocarpa] gi|2... 58 9e-07 ref|XP_002271833.2| PREDICTED: uncharacterized protein LOC100256... 57 1e-06 emb|CAN64499.1| hypothetical protein VITISV_043672 [Vitis vinifera] 57 1e-06 >ref|XP_002519186.1| conserved hypothetical protein [Ricinus communis] gi|223541501|gb|EEF43050.1| conserved hypothetical protein [Ricinus communis] Length = 847 Score = 57.8 bits (138), Expect = 9e-07 Identities = 24/42 (57%), Positives = 36/42 (85%) Frame = -3 Query: 156 SWELKYVKLMLSNIDQMFNDYAMGRACEIISPRLFDQLESCK 31 +WE++YV+ +L N++ MFND+A+GRA EII+P LF+QLE+ K Sbjct: 686 NWEIEYVQKILCNLEYMFNDFALGRASEIINPHLFNQLENRK 727 >ref|XP_002314925.1| predicted protein [Populus trichocarpa] gi|222863965|gb|EEF01096.1| predicted protein [Populus trichocarpa] Length = 933 Score = 57.8 bits (138), Expect = 9e-07 Identities = 30/56 (53%), Positives = 38/56 (67%), Gaps = 2/56 (3%) Frame = -3 Query: 171 TTLTRS--WELKYVKLMLSNIDQMFNDYAMGRACEIISPRLFDQLESCKHYFNDCG 10 T L RS WE++YVK +L NI+ MF D+A+GRA +II+P LF QLE K F G Sbjct: 765 TGLARSTKWEIEYVKKILCNIELMFQDFALGRASKIINPHLFHQLERRKDMFESDG 820 >ref|XP_002271833.2| PREDICTED: uncharacterized protein LOC100256774 [Vitis vinifera] Length = 270 Score = 57.4 bits (137), Expect = 1e-06 Identities = 30/49 (61%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = -3 Query: 171 TTLTRS--WELKYVKLMLSNIDQMFNDYAMGRACEIISPRLFDQLESCK 31 T L RS WEL+YVK +L NI+ MF D+A+GRA EII+P LF QLE+ K Sbjct: 102 TCLVRSTKWELEYVKEILCNIELMFKDFALGRAREIINPHLFHQLENRK 150 >emb|CAN64499.1| hypothetical protein VITISV_043672 [Vitis vinifera] Length = 955 Score = 57.4 bits (137), Expect = 1e-06 Identities = 30/49 (61%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = -3 Query: 171 TTLTRS--WELKYVKLMLSNIDQMFNDYAMGRACEIISPRLFDQLESCK 31 T L RS WEL+YVK +L NI+ MF D+A+GRA EII+P LF QLE+ K Sbjct: 787 TCLVRSTKWELEYVKEILCNIELMFKDFALGRAREIINPHLFHQLENRK 835