BLASTX nr result
ID: Scutellaria22_contig00026326
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00026326 (299 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002522273.1| Carboxy-terminal domain RNA polymerase II po... 60 2e-07 >ref|XP_002522273.1| Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase, putative [Ricinus communis] gi|223538526|gb|EEF40131.1| Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase, putative [Ricinus communis] Length = 300 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/45 (62%), Positives = 36/45 (80%) Frame = +3 Query: 3 QPENAVPIRPFVDDLEDDELKKMMEGFFQGLDLVEDVRKAVKEFV 137 QP+NA+PI+PF+DDL D EL K+ + FF G D VED+R AVK+FV Sbjct: 244 QPDNAIPIKPFIDDLRDGELGKLAK-FFNGCDGVEDMRNAVKQFV 287