BLASTX nr result
ID: Scutellaria22_contig00026226
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00026226 (776 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003637691.1| AAA ATPase containing von Willebrand factor ... 75 2e-11 ref|XP_002533067.1| conserved hypothetical protein [Ricinus comm... 75 2e-11 ref|XP_004136185.1| PREDICTED: uncharacterized protein LOC101206... 74 3e-11 emb|CBI32355.3| unnamed protein product [Vitis vinifera] 74 5e-11 emb|CAN64249.1| hypothetical protein VITISV_032977 [Vitis vinifera] 74 5e-11 >ref|XP_003637691.1| AAA ATPase containing von Willebrand factor type A [Medicago truncatula] gi|355503626|gb|AES84829.1| AAA ATPase containing von Willebrand factor type A [Medicago truncatula] Length = 156 Score = 75.1 bits (183), Expect = 2e-11 Identities = 29/49 (59%), Positives = 39/49 (79%), Gaps = 1/49 (2%) Frame = -1 Query: 275 EEDCCRWVEAIDDVCVCELLLHLPPFLVRPVHNYTVVIG-ACEVTFECG 132 E++CCRW A+D CVCE+L+ LPPFL+RP+H Y+VV G +C VT+ CG Sbjct: 105 EDNCCRWARALDSRCVCEILVRLPPFLIRPLHTYSVVFGESCTVTYSCG 153 >ref|XP_002533067.1| conserved hypothetical protein [Ricinus communis] gi|223527131|gb|EEF29306.1| conserved hypothetical protein [Ricinus communis] Length = 143 Score = 75.1 bits (183), Expect = 2e-11 Identities = 30/51 (58%), Positives = 39/51 (76%), Gaps = 1/51 (1%) Frame = -1 Query: 272 EDCCRWVEAIDDVCVCELLLHLPPFLVRPVHNYTVVIG-ACEVTFECGPKM 123 +DCCRW+ +DD C+CELL+ LPPFL RP+H YTVVI AC VT+ C ++ Sbjct: 91 DDCCRWLNDLDDECICELLVRLPPFLARPLHQYTVVIADACNVTYTCSGRV 141 >ref|XP_004136185.1| PREDICTED: uncharacterized protein LOC101206671 [Cucumis sativus] Length = 149 Score = 74.3 bits (181), Expect = 3e-11 Identities = 30/51 (58%), Positives = 39/51 (76%), Gaps = 1/51 (1%) Frame = -1 Query: 281 PIEEDCCRWVEAIDDVCVCELLLHLPPFLVRPVHNYTVVI-GACEVTFECG 132 PIEE+CC+WV+ +D CVCELL LP FL RP+HN++V I G+C T+ CG Sbjct: 95 PIEENCCKWVQQVDSECVCELLSRLPAFLKRPIHNFSVTIGGSCNATYWCG 145 >emb|CBI32355.3| unnamed protein product [Vitis vinifera] Length = 113 Score = 73.6 bits (179), Expect = 5e-11 Identities = 32/57 (56%), Positives = 40/57 (70%), Gaps = 1/57 (1%) Frame = -1 Query: 290 QPAPIEEDCCRWVEAIDDVCVCELLLHLPPFLVRPVHNYTVVIG-ACEVTFECGPKM 123 Q + EE CCRW++ IDD CVC+LL HLP FL RP H YTV + +C VTF CG ++ Sbjct: 55 QQSSAEEACCRWLKEIDDECVCDLLAHLPLFLTRPSHYYTVSVDPSCSVTFSCGGRL 111 >emb|CAN64249.1| hypothetical protein VITISV_032977 [Vitis vinifera] Length = 160 Score = 73.6 bits (179), Expect = 5e-11 Identities = 32/57 (56%), Positives = 40/57 (70%), Gaps = 1/57 (1%) Frame = -1 Query: 290 QPAPIEEDCCRWVEAIDDVCVCELLLHLPPFLVRPVHNYTVVIG-ACEVTFECGPKM 123 Q + EE CCRW++ IDD CVC+LL HLP FL RP H YTV + +C VTF CG ++ Sbjct: 102 QQSSAEEACCRWLKEIDDECVCDLLAHLPLFLTRPSHYYTVSVDPSCSVTFSCGGRL 158