BLASTX nr result
ID: Scutellaria22_contig00026037
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00026037 (242 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002278446.1| PREDICTED: uncharacterized protein LOC100241... 58 7e-07 ref|XP_002511891.1| hypothetical protein RCOM_1616170 [Ricinus c... 56 3e-06 >ref|XP_002278446.1| PREDICTED: uncharacterized protein LOC100241428 [Vitis vinifera] gi|297745355|emb|CBI40435.3| unnamed protein product [Vitis vinifera] Length = 291 Score = 58.2 bits (139), Expect = 7e-07 Identities = 21/45 (46%), Positives = 36/45 (80%) Frame = -3 Query: 153 KGEEIVLCCKTDGKSWQCRREAAKGNSLCDHHLSLMKSYSTNSSS 19 K + I+ C K+DGK WQCR+ A +G++LC+HHL+ ++SY++++ S Sbjct: 125 KNKTILFCNKSDGKGWQCRKAAKEGHALCEHHLAQLRSYNSSNQS 169 >ref|XP_002511891.1| hypothetical protein RCOM_1616170 [Ricinus communis] gi|223549071|gb|EEF50560.1| hypothetical protein RCOM_1616170 [Ricinus communis] Length = 311 Score = 55.8 bits (133), Expect = 3e-06 Identities = 24/47 (51%), Positives = 32/47 (68%), Gaps = 2/47 (4%) Frame = -3 Query: 153 KGEEIVLCCKTDGKSWQCRREAAKGNSLCDHHL--SLMKSYSTNSSS 19 KGE+I C K DGK W C+ E +G+S+CDHH+ SL SY+ N +S Sbjct: 131 KGEKIYCCNKIDGKEWHCKNELKEGHSMCDHHILSSLKSSYNNNVTS 177