BLASTX nr result
ID: Scutellaria22_contig00025987
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00025987 (444 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAA84691.1| unknown [Nicotiana tabacum] 58 9e-07 gb|ABN08797.1| hypothetical protein MtrDRAFT_AC160516g49v2 [Medi... 57 2e-06 >gb|AAA84691.1| unknown [Nicotiana tabacum] Length = 35 Score = 57.8 bits (138), Expect = 9e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +3 Query: 258 SRWAAMVKLVDTLLLGSSARASRFESEWRHVI 353 SR AAMVKLVDTLLLGSSA ASRFESEWRH + Sbjct: 3 SRQAAMVKLVDTLLLGSSANASRFESEWRHTV 34 >gb|ABN08797.1| hypothetical protein MtrDRAFT_AC160516g49v2 [Medicago truncatula] Length = 40 Score = 56.6 bits (135), Expect = 2e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 352 MTCRHSDSNRDALALLPKSSVSTNFTIAAH 263 M CR+SDSNRDALALLPKSSVSTNFTIAA+ Sbjct: 8 MPCRYSDSNRDALALLPKSSVSTNFTIAAY 37