BLASTX nr result
ID: Scutellaria22_contig00025959
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00025959 (452 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002300997.1| AP2/ERF domain-containing transcription fact... 57 2e-06 ref|XP_002337051.1| AP2/ERF domain-containing transcription fact... 57 2e-06 >ref|XP_002300997.1| AP2/ERF domain-containing transcription factor [Populus trichocarpa] gi|222842723|gb|EEE80270.1| AP2/ERF domain-containing transcription factor [Populus trichocarpa] Length = 215 Score = 56.6 bits (135), Expect = 2e-06 Identities = 32/63 (50%), Positives = 44/63 (69%), Gaps = 5/63 (7%) Frame = -1 Query: 224 DDHISL-DDYKVQLEEPGVLASWYNFD---SPKY-NEMLNGVFFDPLMMEDCYEDSDIRL 60 DD++SL + ++ E +L SWYNFD SPKY ++M NGV F+P M++D YE DIRL Sbjct: 152 DDYMSLMESFETDNEPIPMLDSWYNFDGLQSPKYIDQMFNGVSFNPPMIDDFYE-GDIRL 210 Query: 59 WSY 51 WS+ Sbjct: 211 WSF 213 >ref|XP_002337051.1| AP2/ERF domain-containing transcription factor [Populus trichocarpa] gi|148372138|gb|ABQ63000.1| RAP2-like protein [Populus trichocarpa] gi|222837922|gb|EEE76287.1| AP2/ERF domain-containing transcription factor [Populus trichocarpa] Length = 214 Score = 56.6 bits (135), Expect = 2e-06 Identities = 32/63 (50%), Positives = 44/63 (69%), Gaps = 5/63 (7%) Frame = -1 Query: 224 DDHISL-DDYKVQLEEPGVLASWYNFD---SPKY-NEMLNGVFFDPLMMEDCYEDSDIRL 60 DD++SL + ++ E +L SWYNFD SPKY ++M NGV F+P M++D YE DIRL Sbjct: 151 DDYMSLMESFETDNEPIPMLDSWYNFDGLQSPKYIDQMFNGVSFNPPMIDDFYE-GDIRL 209 Query: 59 WSY 51 WS+ Sbjct: 210 WSF 212