BLASTX nr result
ID: Scutellaria22_contig00025874
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00025874 (360 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002269137.2| PREDICTED: uncharacterized protein LOC100250... 55 8e-06 >ref|XP_002269137.2| PREDICTED: uncharacterized protein LOC100250032 [Vitis vinifera] Length = 327 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -1 Query: 360 MEKKRMEMIVEAQRKIVDTIGRAFGAHKKAKMVQE 256 ME +RMEMIVE+QRKIV+TIGRA G++KK KM QE Sbjct: 292 MESRRMEMIVESQRKIVETIGRALGSNKKLKMSQE 326